Project name: c9960552b4dd0f7

Status: done

Started: 2026-03-09 08:26:17
Chain sequence(s) A: DAKVEQSPSSLTVPEGATANIPCNHSTISGNEYVYWYRQDPGEGPQYIIHGLKNNETNERAKLIITEDRKSSTLILPHVTPRDTAVYYCIVLDNYGQNFVFGPGTRLTVTPGGGSEGGGSEGGGSEGGGSEGGTGEAGVEQSPSSLTVPEGASVAIWCNPISGHATLYWYQQDPGEGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPVKPEDSAVYLCASSLGLTGQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c9960552b4dd0f7/tmp/folded.pdb                (00:04:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:03)
Show buried residues

Minimal score value
-3.5224
Maximal score value
1.8031
Average score
-0.9027
Total score value
-222.9747

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -2.3766
2 A A -1.8182
3 K A -2.6377
4 V A -1.8834
5 E A -2.2474
6 Q A 0.0000
7 S A -0.8949
8 P A -0.7771
9 S A -0.9954
10 S A -0.8478
11 L A -0.4395
12 T A -0.3287
13 V A -0.4355
14 P A -1.2156
15 E A -2.1533
16 G A -1.5214
17 A A -1.1091
18 T A -0.8727
19 A A 0.0000
20 N A -0.9744
21 I A 0.0000
22 P A -0.7683
23 C A 0.0000
24 N A -2.3133
25 H A 0.0000
26 S A -1.7529
27 T A -1.4850
28 I A -1.4610
29 S A -1.0096
30 G A -1.4579
31 N A -1.5758
32 E A -0.8583
33 Y A -0.0371
34 V A 0.0000
35 Y A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 R A -1.0930
39 Q A -1.5158
40 D A -2.0709
41 P A -1.3218
42 G A -1.8670
43 E A -2.5442
44 G A -1.2300
45 P A 0.0000
46 Q A -1.0991
47 Y A -0.0257
48 I A 0.0000
49 I A 0.0000
50 H A -0.6297
51 G A 0.0000
52 L A -1.3925
53 K A -3.2868
54 N A -3.0870
55 N A -2.8614
56 E A -2.4188
57 T A -1.9509
58 N A -2.0946
59 E A -2.5937
60 R A -2.1366
61 A A 0.0000
62 K A -1.7193
63 L A 0.0000
64 I A -0.9184
65 I A 0.0000
66 T A -2.3190
67 E A -3.5224
68 D A -3.3381
69 R A 0.0000
70 K A -2.5176
71 S A -1.8005
72 S A 0.0000
73 T A -0.4251
74 L A 0.0000
75 I A -0.5204
76 L A 0.0000
77 P A -1.3022
78 H A -1.6309
79 V A 0.0000
80 T A -1.6840
81 P A -1.5714
82 R A -2.2704
83 D A -1.6848
84 T A -1.2204
85 A A 0.0000
86 V A -0.7732
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 I A 0.0000
91 V A 0.0000
92 L A 0.0000
93 D A -1.1286
94 N A -1.5122
95 Y A 0.1510
96 G A -0.2047
97 Q A -0.1634
98 N A 0.0000
99 F A 0.0000
100 V A -0.5626
101 F A -0.5960
102 G A 0.0000
103 P A -1.2808
104 G A 0.0000
105 T A 0.0000
106 R A -1.7688
107 L A 0.0000
108 T A -0.8383
109 V A 0.0000
110 T A -0.8072
111 P A -1.1526
112 G A -1.4496
113 G A -1.4487
114 G A -1.4990
115 S A -1.6561
116 E A -2.5293
117 G A -1.9071
118 G A -1.4009
119 G A -1.5308
120 S A -1.5445
121 E A -2.3640
122 G A -1.7546
123 G A -1.5403
124 G A -1.4546
125 S A -1.6013
126 E A -2.5135
127 G A -1.8420
128 G A -1.7416
129 G A -1.7025
130 S A -1.6890
131 E A -2.4594
132 G A -1.7843
133 G A -1.5881
134 T A -1.3215
135 G A -1.6488
136 E A -2.1981
137 A A -1.4258
138 G A -1.1906
139 V A 0.0000
140 E A -1.9921
141 Q A 0.0000
142 S A -0.5207
143 P A -0.5942
144 S A -0.8944
145 S A -0.7810
146 L A -0.2599
147 T A -0.3219
148 V A -0.4089
149 P A -1.2700
150 E A -2.6520
151 G A -1.7830
152 A A -1.1967
153 S A -1.1808
154 V A 0.0000
155 A A -0.3968
156 I A 0.0000
157 W A -0.3100
158 C A 0.0000
159 N A -0.6799
160 P A 0.0000
161 I A -0.0192
162 S A 0.0412
163 G A -0.0950
164 H A 0.0000
165 A A -0.1519
166 T A 0.0000
167 L A 0.0000
168 Y A 0.0000
169 W A 0.0000
170 Y A 0.0000
171 Q A -1.1009
172 Q A 0.0000
173 D A -2.0572
174 P A -1.3917
175 G A -1.8959
176 E A -2.6600
177 G A -1.4876
178 P A 0.0000
179 K A -1.8407
180 L A 0.0000
181 L A 0.0000
182 I A 0.0000
183 Q A 0.0000
184 F A 0.0000
185 Q A -0.9028
186 N A -1.7978
187 N A -2.0469
188 G A -0.6382
189 V A 1.0873
190 V A 1.5742
191 D A 0.2894
192 D A -0.6414
193 S A -1.0080
194 Q A -1.6603
195 L A 0.0000
196 P A -1.9058
197 K A -3.0699
198 D A -2.9570
199 R A -2.3626
200 F A 0.0000
201 S A -1.8892
202 A A -1.2100
203 E A -2.0737
204 R A 0.0000
205 L A -0.8284
206 K A -1.7873
207 G A -1.3859
208 V A 0.6269
209 D A -0.3334
210 S A 0.0000
211 T A -0.6868
212 L A 0.0000
213 K A -1.4987
214 I A 0.0000
215 Q A -2.1856
216 P A -1.8229
217 V A 0.0000
218 K A -2.1657
219 P A -1.8563
220 E A -2.3969
221 D A 0.0000
222 S A -1.1576
223 A A 0.0000
224 V A -0.8099
225 Y A 0.0000
226 L A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 L A 1.8031
232 G A 0.9329
233 L A 1.5684
234 T A 1.1344
235 G A 0.7204
236 Q A 0.0000
237 Y A 1.2863
238 F A 0.0201
239 G A 0.0000
240 P A -1.5951
241 G A 0.0000
242 T A 0.0000
243 R A -1.6127
244 L A 0.0000
245 T A -0.7866
246 V A -0.9769
247 T A -0.7309
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.49 2.485 View CSV PDB
4.5 -0.5501 2.485 View CSV PDB
5.0 -0.6287 2.485 View CSV PDB
5.5 -0.7125 2.485 View CSV PDB
6.0 -0.7858 2.485 View CSV PDB
6.5 -0.8346 2.485 View CSV PDB
7.0 -0.8539 2.485 View CSV PDB
7.5 -0.8501 2.485 View CSV PDB
8.0 -0.8327 2.4849 View CSV PDB
8.5 -0.8069 2.4848 View CSV PDB
9.0 -0.7747 2.4844 View CSV PDB