Project name: ValAla_R5

Status: done

Started: 2026-08-20 09:18:10
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:35)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ca36162e1588e6a/tmp/folded.pdb                (00:02:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:39)
Show buried residues

Minimal score value
-2.5859
Maximal score value
1.9305
Average score
-0.5518
Total score value
-136.8479

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6954
2 V A 0.0000
3 Q A -2.0739
4 L A 0.0000
5 Q A -1.8510
6 E A 0.0000
7 S A -0.6967
8 G A -0.4363
9 P A -0.0907
10 G A 0.1990
11 L A 0.6066
12 V A 0.0000
13 K A -1.6979
14 P A -1.3050
15 S A -1.3930
16 Q A -1.9149
17 T A -1.5285
18 L A 0.0000
19 S A -0.8557
20 L A 0.0000
21 T A -0.5765
22 V A 0.0000
23 T A -1.2361
24 V A 0.0000
25 S A -1.3928
26 G A -1.4172
27 G A -1.0878
28 S A -0.7203
29 I A 0.0000
30 S A -0.2626
31 S A -0.3203
32 G A -0.0996
33 D A -0.0495
34 Y A 0.6120
35 Y A 0.6068
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6987
43 P A -0.7001
44 G A -1.1337
45 C A -1.2308
46 K A -2.0495
47 G A -1.2871
48 L A 0.0000
49 E A -0.7632
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1632
54 I A 0.0000
55 Y A 0.3473
56 Y A 0.3822
57 S A -0.0707
58 G A -0.2183
59 S A -0.2384
60 T A -0.2217
61 D A -0.6829
62 Y A -0.6945
63 N A -0.9109
64 P A -1.1559
65 S A -1.1073
66 L A 0.0000
67 K A -2.0968
68 S A -1.4245
69 R A -1.6172
70 V A 0.0000
71 T A -0.9762
72 M A 0.0000
73 S A -0.2921
74 V A -0.3383
75 D A -1.1772
76 T A -1.0366
77 S A -1.3301
78 K A -2.1707
79 N A -1.4489
80 Q A -1.3253
81 F A 0.0000
82 S A -0.4423
83 L A 0.0000
84 K A -1.2912
85 V A 0.0000
86 N A -1.7211
87 S A -1.4869
88 V A 0.0000
89 T A -0.6631
90 A A -0.3361
91 A A -0.1859
92 D A 0.0000
93 T A 0.2528
94 A A 0.0000
95 V A 0.2790
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.4226
104 F A 1.9305
105 G A 0.6383
106 V A 0.5869
107 G A 0.7001
108 T A 0.0000
109 F A 0.0000
110 D A -0.5745
111 Y A -0.6626
112 W A -0.9001
113 G A 0.0000
114 Q A -1.6020
115 G A -0.7031
116 T A -0.1293
117 L A 0.8882
118 V A 0.0000
119 T A 0.2490
120 V A 0.0000
121 S A -0.3715
122 S A -0.6680
123 A A -0.5059
124 A A -0.3554
125 G A -0.8404
126 G A -1.0818
127 G A -1.1538
128 G A -1.1746
129 S A -1.0285
130 G A -1.1883
131 G A -1.2041
132 G A -1.2033
133 G A -1.2193
134 S A -1.0761
135 G A -1.2209
136 G A -1.4108
137 G A -1.3044
138 G A -1.1448
139 S A -0.8987
140 D A -0.8524
141 I A -0.0861
142 V A 1.0205
143 M A 0.0000
144 T A -0.5906
145 Q A -0.6769
146 S A -0.7605
147 P A -0.3589
148 A A -0.3826
149 T A -0.5319
150 L A -0.2598
151 S A -0.4017
152 L A -0.5768
153 S A -0.8609
154 P A -1.4100
155 G A -1.6957
156 E A -2.1090
157 R A -2.5859
158 A A 0.0000
159 T A -0.6128
160 L A 0.0000
161 S A -0.8880
162 V A 0.0000
163 R A -2.3383
164 A A 0.0000
165 S A -0.8458
166 Q A -1.5676
167 S A -1.2530
168 V A 0.0000
169 S A -0.5476
170 S A -0.3229
171 Y A 0.5779
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5974
179 P A -0.8962
180 G A -0.9767
181 C A -1.0196
182 Q A -1.6082
183 A A -1.3021
184 P A 0.0000
185 R A -2.0187
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5632
190 D A -0.7395
191 A A 0.0000
192 S A -1.1061
193 N A -1.6869
194 R A -1.6420
195 A A -1.1060
196 T A -0.6514
197 G A -0.5699
198 I A -0.6002
199 P A -0.3758
200 A A -0.3766
201 R A -0.7826
202 F A 0.0000
203 S A -0.7330
204 G A 0.0000
205 S A -0.8215
206 G A -1.1065
207 S A -0.9600
208 G A -1.0686
209 T A -1.7511
210 D A -2.1509
211 F A 0.0000
212 T A -0.7461
213 L A 0.0000
214 T A -0.6194
215 I A 0.0000
216 S A -1.4519
217 S A -1.7351
218 L A 0.0000
219 E A -2.3054
220 P A -1.5129
221 E A -2.3419
222 D A 0.0000
223 F A -0.7676
224 A A 0.0000
225 V A -0.6653
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.2097
233 S A -0.2905
234 T A -0.4404
235 P A -0.4332
236 L A 0.0000
237 T A 0.1371
238 F A 0.2351
239 G A 0.0000
240 G A -0.8172
241 G A -0.7935
242 T A 0.0000
243 K A -1.1530
244 A A 0.0000
245 E A -0.5159
246 I A 0.8054
247 K A -0.8059
248 A A -0.3090
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.507 4.848 View CSV PDB
4.5 -0.5282 4.8149 View CSV PDB
5.0 -0.5527 4.7709 View CSV PDB
5.5 -0.575 4.7215 View CSV PDB
6.0 -0.5886 4.6701 View CSV PDB
6.5 -0.5891 4.6181 View CSV PDB
7.0 -0.5771 4.5659 View CSV PDB
7.5 -0.5567 4.514 View CSV PDB
8.0 -0.5318 4.4629 View CSV PDB
8.5 -0.5036 4.4144 View CSV PDB
9.0 -0.4723 4.3724 View CSV PDB