Project name: 7io

Status: done

Started: 2026-05-10 14:52:44
Chain sequence(s) A: STAVEELQSAISDLESALSFLNLNKIEEAKTKIKNAISSLKVAISALPENSSFKGILETSIAVLNLVLKELDKPSPDLDAVKDIISIEISFLKKVLSAMS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:36)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/cb3042b4f3e2cc5/tmp/folded.pdb                (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:18)
Show buried residues

Minimal score value
-3.2672
Maximal score value
1.8328
Average score
-0.9309
Total score value
-93.0869

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -0.6822
2 T A -0.7262
3 A A 0.0000
4 V A -0.9970
5 E A -2.1718
6 E A -1.6037
7 L A 0.0000
8 Q A -1.9267
9 S A -1.5259
10 A A 0.0000
11 I A 0.0000
12 S A -1.2281
13 D A 0.0000
14 L A 0.0000
15 E A -1.6778
16 S A -1.1728
17 A A 0.0000
18 L A -0.9660
19 S A -0.8041
20 F A -0.9462
21 L A 0.0000
22 N A -1.1338
23 L A 0.0923
24 N A -1.5001
25 K A -1.8956
26 I A -1.8154
27 E A -2.9587
28 E A -2.5396
29 A A 0.0000
30 K A -2.2687
31 T A -2.0801
32 K A -2.2235
33 I A 0.0000
34 K A -2.6085
35 N A -2.2806
36 A A 0.0000
37 I A 0.0000
38 S A -1.2734
39 S A 0.0000
40 L A 0.0000
41 K A -1.6385
42 V A -0.0312
43 A A 0.0000
44 I A -0.7580
45 S A -0.4525
46 A A -0.2716
47 L A -0.4942
48 P A -1.5091
49 E A -2.5779
50 N A -2.3385
51 S A -1.3180
52 S A -0.7386
53 F A -0.4207
54 K A -1.4263
55 G A -1.0106
56 I A -0.0660
57 L A 0.0000
58 E A -1.9626
59 T A -0.7481
60 S A 0.0000
61 I A -0.6840
62 A A 0.1230
63 V A 0.5271
64 L A 0.0000
65 N A -0.2227
66 L A 0.7359
67 V A 0.0000
68 L A -1.3395
69 K A -2.2466
70 E A -2.1140
71 L A 0.0000
72 D A -3.2672
73 K A -3.2333
74 P A -1.7359
75 S A -1.5047
76 P A -2.3599
77 D A -2.4661
78 L A -2.0564
79 D A -2.8614
80 A A -1.9801
81 V A 0.0000
82 K A -1.8496
83 D A -1.6368
84 I A 0.2825
85 I A 0.0000
86 S A 0.2299
87 I A 1.8328
88 E A 0.0000
89 I A -0.0422
90 S A 0.1574
91 F A 0.4011
92 L A 0.0000
93 K A -1.9842
94 K A -2.0642
95 V A 0.0000
96 L A -1.0742
97 S A -0.9890
98 A A -0.5489
99 M A -0.1772
100 S A -0.2619
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7534 3.0318 View CSV PDB
4.5 -0.8474 2.9408 View CSV PDB
5.0 -0.9682 2.8349 View CSV PDB
5.5 -1.091 2.7248 View CSV PDB
6.0 -1.1868 2.6169 View CSV PDB
6.5 -1.2348 2.5147 View CSV PDB
7.0 -1.2326 2.4181 View CSV PDB
7.5 -1.1931 2.3258 View CSV PDB
8.0 -1.1326 2.2386 View CSV PDB
8.5 -1.0586 2.1627 View CSV PDB
9.0 -0.9713 2.1102 View CSV PDB