Project name: GC253_11F8 [mutate: CA22A, CA98A, CA162A, CA228A] [mutate: AV22A, AV162A] [mutate: VA22A, AV98A, VA162A, AV228A]

Status: done

Started: 2026-08-20 08:40:47
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues VA22A,AV98A,VA162A,AV228A
Energy difference between WT (input) and mutated protein (by FoldX) 2.24254 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:33)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:41)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/cef5303f353c89/tmp/folded.pdb                 (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-2.6761
Maximal score value
1.9036
Average score
-0.5803
Total score value
-143.9052

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6979
2 V A 0.0000
3 Q A -2.0579
4 L A 0.0000
5 Q A -1.8650
6 E A 0.0000
7 S A -0.7218
8 G A -0.4376
9 P A -0.0145
10 G A 0.3233
11 L A 0.8559
12 V A 0.0000
13 K A -1.8438
14 P A -1.3738
15 S A -1.4703
16 Q A -2.0216
17 T A -1.8051
18 L A 0.0000
19 S A -1.0967
20 L A 0.0000
21 T A -0.6560
22 A A 0.0000 mutated: VA22A
23 T A -1.2456
24 V A 0.0000
25 S A -1.3871
26 G A -1.4230
27 G A -1.1101
28 S A -0.6960
29 I A 0.0000
30 S A -0.3810
31 S A -0.3887
32 G A -0.2089
33 D A -0.2665
34 Y A 0.4225
35 Y A 0.4274
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2405
41 Q A 0.0000
42 P A -0.7363
43 P A -0.6764
44 G A -1.1333
45 C A -1.2817
46 K A -2.0325
47 G A -1.2500
48 L A 0.0000
49 E A -0.8349
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.0808
54 I A 0.0000
55 Y A 0.1504
56 Y A 0.0620
57 S A -0.2238
58 G A -0.3172
59 S A -0.3013
60 T A -0.2981
61 D A -0.7489
62 Y A -0.8316
63 N A -1.0644
64 P A -1.3887
65 S A -1.1696
66 L A 0.0000
67 K A -2.1861
68 S A -1.5367
69 R A -1.8660
70 V A 0.0000
71 T A -1.2584
72 M A 0.0000
73 S A -0.4597
74 V A -0.4657
75 D A -1.3246
76 T A -1.1368
77 S A -1.3787
78 K A -2.2050
79 N A -1.5062
80 Q A -1.3338
81 F A 0.0000
82 S A -0.5949
83 L A 0.0000
84 K A -1.8511
85 V A 0.0000
86 N A -2.2158
87 S A -1.7130
88 V A 0.0000
89 T A -0.8282
90 A A -0.3049
91 A A -0.0382
92 D A 0.0000
93 T A 0.2511
94 A A 0.0000
95 V A 0.1815
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000 mutated: AV98A
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.3946
104 F A 1.9036
105 G A 0.6941
106 V A 0.8204
107 G A 0.8650
108 T A 0.0000
109 F A 0.0000
110 D A -0.5463
111 Y A -0.6490
112 W A -0.8671
113 G A 0.0000
114 Q A -1.6383
115 G A -0.7720
116 T A -0.2143
117 L A 0.8091
118 V A 0.0000
119 T A 0.3131
120 V A 0.0000
121 S A -0.4145
122 S A -0.6623
123 A A -0.6648
124 A A -0.3643
125 G A -0.8436
126 G A -1.0832
127 G A -1.1265
128 G A -1.1731
129 S A -1.0347
130 G A -1.1564
131 G A -1.2038
132 G A -1.2040
133 G A -1.2235
134 S A -1.0192
135 G A -1.1910
136 G A -1.1912
137 G A -1.2202
138 G A -1.2078
139 S A -1.0319
140 D A -1.0407
141 I A -0.2129
142 V A 0.9473
143 M A 0.0000
144 T A -0.5902
145 Q A -0.6654
146 S A -0.7167
147 P A -0.3328
148 A A -0.3453
149 T A -0.4509
150 L A -0.2175
151 S A -0.3598
152 L A -0.6737
153 S A -0.9828
154 P A -1.5190
155 G A -1.8020
156 E A -2.3741
157 R A -2.6761
158 A A 0.0000
159 T A -0.6664
160 L A 0.0000
161 S A -0.8891
162 A A 0.0000 mutated: VA162A
163 R A -2.3274
164 A A 0.0000
165 S A -0.8811
166 Q A -1.5930
167 S A -1.2367
168 V A 0.0000
169 S A -0.5077
170 S A -0.2222
171 Y A 0.6809
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5048
179 P A -0.9773
180 G A -0.9596
181 C A -1.0965
182 Q A -1.4987
183 A A -1.1655
184 P A 0.0000
185 R A -1.5474
186 L A -0.8041
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4109
190 D A -0.5113
191 A A 0.0000
192 S A -1.0662
193 N A -1.5796
194 R A -2.0362
195 A A -1.2389
196 T A -0.7364
197 G A -0.7433
198 I A 0.0000
199 P A -0.5314
200 A A -0.4926
201 R A -0.7443
202 F A 0.0000
203 S A -0.8592
204 G A -0.8307
205 S A -0.7967
206 G A -1.1000
207 S A -0.9381
208 G A -1.0647
209 T A -1.7547
210 D A -2.1719
211 F A 0.0000
212 T A -0.7869
213 L A 0.0000
214 T A -0.6145
215 I A 0.0000
216 S A -1.3679
217 S A -1.7281
218 L A 0.0000
219 E A -2.3231
220 P A -1.5405
221 E A -2.3848
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6435
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000 mutated: AV228A
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1315
233 S A -0.3150
234 T A -0.4824
235 P A -0.5705
236 L A 0.0000
237 T A 0.1040
238 F A 0.2442
239 G A 0.0000
240 G A -0.8079
241 G A -0.7811
242 T A 0.0000
243 K A -0.8723
244 A A 0.0000
245 E A -0.4849
246 I A 0.6748
247 K A -0.8815
248 A A -0.3454
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.545 4.8877 View CSV PDB
4.5 -0.5661 4.8775 View CSV PDB
5.0 -0.5905 4.8539 View CSV PDB
5.5 -0.6129 4.8125 View CSV PDB
6.0 -0.6265 4.7577 View CSV PDB
6.5 -0.6265 4.6963 View CSV PDB
7.0 -0.6135 4.6326 View CSV PDB
7.5 -0.5922 4.568 View CSV PDB
8.0 -0.5662 4.5033 View CSV PDB
8.5 -0.5366 4.4389 View CSV PDB
9.0 -0.5038 4.3755 View CSV PDB