Project name: ceff487664a2023

Status: done

Started: 2026-04-11 12:24:52
Chain sequence(s) A: QKEVEQSPGPLSVPEGATVSLNCTYSNSAFQYFLWYRQDPGEGPELLMYTYSSGNKEKGRFTLKVDKSRKRISLRIRDVQPSDSATYLCAMSADNYGQNFVFGPGTRLTVTPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPESITLPEGASMTLQCRQDMNHEYMLWYRQDPGKGLILIFYSVGAGITDQGEVPEGYSVSRPTLEDFPLRLLSAQPEDTAVYFCASSYSVGEGNLGDTQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:02)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ceff487664a2023/tmp/folded.pdb                (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:15)
Show buried residues

Minimal score value
-3.6358
Maximal score value
1.5728
Average score
-0.8692
Total score value
-219.9028

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -2.4150
2 K A -3.0488
3 E A -2.3483
4 V A 0.0000
5 E A -2.8227
6 Q A -1.4566
7 S A -1.0267
8 P A -0.9630
9 G A -1.0160
10 P A -1.1374
11 L A -0.4153
12 S A -0.4218
13 V A -0.3433
14 P A -1.2705
15 E A -2.1626
16 G A -2.1382
17 A A -1.5100
18 T A -1.5567
19 V A 0.0000
20 S A -0.7421
21 L A 0.0000
22 N A -1.1670
23 C A 0.0000
24 T A -2.0437
25 Y A 0.0000
26 S A -1.7938
27 N A -1.0069
28 S A -0.8876
29 A A -0.5677
30 F A 0.0000
31 Q A -0.9968
32 Y A 0.0024
33 F A 0.0000
34 L A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 R A -1.2690
38 Q A -1.5507
39 D A -1.7017
40 P A -1.3563
41 G A -1.7319
42 E A -2.0871
43 G A -1.2147
44 P A 0.0000
45 E A -1.4165
46 L A -0.2518
47 L A 0.0000
48 M A 0.0000
49 Y A 0.4904
50 T A 0.1579
51 Y A 0.8576
52 S A -0.3153
53 S A -1.0206
54 G A -1.3513
55 N A -2.5518
56 K A -2.8186
57 E A -3.6358
58 K A -3.0414
59 G A -2.1095
60 R A -2.3747
61 F A -2.1770
62 T A 0.0000
63 L A 0.0000
64 K A -2.0338
65 V A 0.0000
66 D A -2.0736
67 K A -2.3120
68 S A -1.8797
69 R A -2.7969
70 K A -2.4006
71 R A -2.3424
72 I A 0.0000
73 S A 0.0000
74 L A 0.0000
75 R A -1.3876
76 I A 0.0000
77 R A -2.7599
78 D A -3.0160
79 V A 0.0000
80 Q A -1.7097
81 P A -0.8606
82 S A -0.6272
83 D A 0.0000
84 S A -0.7704
85 A A 0.0000
86 T A 0.0000
87 Y A 0.0000
88 L A 0.0000
89 C A 0.0000
90 A A 0.0000
91 M A 0.0000
92 S A 0.0000
93 A A -0.6580
94 D A -0.6098
95 N A 0.0218
96 Y A 0.7460
97 G A 0.0000
98 Q A -0.5126
99 N A -1.4218
100 F A 0.0000
101 V A -0.2833
102 F A 0.0000
103 G A 0.0000
104 P A -1.4549
105 G A -1.4412
106 T A 0.0000
107 R A -2.2094
108 L A 0.0000
109 T A -0.7557
110 V A 0.0000
111 T A -0.8559
112 P A -1.1878
113 G A -1.4287
114 G A -1.4390
115 G A -1.4963
116 S A -1.6863
117 E A -2.5137
118 G A -1.8319
119 G A -1.4674
120 G A -1.5630
121 S A -1.5808
122 E A -2.3549
123 G A -1.7447
124 G A -1.3328
125 G A -1.3383
126 S A -1.6052
127 E A -2.4179
128 G A -1.7816
129 G A -1.6332
130 G A -1.7301
131 S A -1.7425
132 E A -2.5068
133 G A -1.8092
134 G A -1.5504
135 T A -1.1805
136 G A -1.2718
137 N A -1.0912
138 A A -0.6539
139 G A -1.0957
140 V A 0.0000
141 T A -1.2002
142 Q A 0.0000
143 T A -1.2046
144 P A -1.2689
145 E A -2.3744
146 S A -1.5156
147 I A -0.4663
148 T A -0.3670
149 L A 0.0000
150 P A -1.3716
151 E A -2.4021
152 G A -1.4654
153 A A -0.7703
154 S A -0.4115
155 M A -0.0063
156 T A -0.4338
157 L A 0.0000
158 Q A -1.1465
159 C A 0.0000
160 R A -2.2799
161 Q A 0.0000
162 D A -2.6164
163 M A -1.4836
164 N A -1.9195
165 H A 0.0000
166 E A -0.6180
167 Y A 0.0000
168 M A 0.0000
169 L A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A -0.3762
173 Q A -0.7381
174 D A 0.0000
175 P A -0.8947
176 G A -1.6003
177 K A -1.7316
178 G A -0.8410
179 L A 0.0000
180 I A -0.3848
181 L A 0.0000
182 I A 0.0000
183 F A 0.0000
184 Y A -0.4301
185 S A 0.0000
186 V A 0.8318
187 G A 0.4640
188 A A 0.2377
189 G A 0.4845
190 I A 1.5728
191 T A -0.0104
192 D A -1.5597
193 Q A -2.4911
194 G A -2.1244
195 E A -2.2348
196 V A -1.2605
197 P A -1.8317
198 E A -2.2191
199 G A -1.2834
200 Y A 0.0000
201 S A -0.7773
202 V A -0.3569
203 S A -0.2560
204 R A 0.0000
205 P A -0.2878
206 T A -0.6271
207 L A -0.8697
208 E A -2.1750
209 D A -1.5045
210 F A 0.0000
211 P A -0.7974
212 L A 0.0000
213 R A -1.0080
214 L A 0.0000
215 L A 0.0411
216 S A -0.6576
217 A A 0.0000
218 Q A -1.9269
219 P A -1.8076
220 E A -2.0718
221 D A 0.0000
222 T A -1.0554
223 A A 0.0000
224 V A -0.7662
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 Y A 0.4870
232 S A 0.3473
233 V A 0.3676
234 G A -1.0086
235 E A -2.2442
236 G A -1.5684
237 N A -0.9704
238 L A 0.0800
239 G A 0.0000
240 D A 0.0000
241 T A 0.2520
242 Q A 0.0000
243 Y A 0.3029
244 F A 0.0000
245 G A 0.0000
246 P A -1.3705
247 G A 0.0000
248 T A 0.0000
249 R A -2.2088
250 L A 0.0000
251 T A -0.8024
252 V A -0.9730
253 T A -0.7795
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.481 3.3304 View CSV PDB
4.5 -0.5372 3.2725 View CSV PDB
5.0 -0.6117 3.2015 View CSV PDB
5.5 -0.6924 3.125 View CSV PDB
6.0 -0.7663 3.0465 View CSV PDB
6.5 -0.8211 2.9674 View CSV PDB
7.0 -0.851 2.8883 View CSV PDB
7.5 -0.8611 2.8099 View CSV PDB
8.0 -0.8604 2.7335 View CSV PDB
8.5 -0.8536 2.6628 View CSV PDB
9.0 -0.8417 2.6056 View CSV PDB