Project name: 15 FULL

Status: done

Started: 2026-06-05 10:50:56
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRETGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYWINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
B: DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d02d8ed968d6bb8/tmp/folded.pdb                (00:06:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:14)
Show buried residues

Minimal score value
-3.5699
Maximal score value
3.041
Average score
-0.5857
Total score value
-175.1363

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.4679
2 I A 0.0000
3 V A 0.6333
4 M A 0.0000
5 T A -0.5772
6 Q A 0.0000
7 S A -0.3094
8 P A 0.0900
9 L A 0.6662
10 S A -0.0802
11 L A -0.3746
12 P A -1.2153
13 V A 0.0000
14 T A -1.7234
15 P A -1.8791
16 G A -1.8968
17 E A -2.2584
18 P A -2.1681
19 A A 0.0000
20 S A -0.9123
21 I A 0.0000
22 S A -1.0061
23 C A 0.0000
24 R A -2.3426
25 S A 0.0000
26 S A -0.9871
27 Q A -1.5326
28 S A -0.9681
29 L A 0.0000
30 L A -0.1691
31 N A 0.0000
32 G A -0.4096
33 Y A 0.4526
34 N A -0.5546
35 Q A -1.4010
36 K A -1.2365
37 N A -0.6763
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A -0.8300
45 K A -1.4697
46 P A -1.0510
47 G A -1.4435
48 Q A -1.8773
49 S A -1.1743
50 P A 0.0000
51 Q A -0.8525
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.5322
57 A A 0.0000
58 S A -0.7142
59 T A -0.5578
60 R A -1.2331
61 E A -0.7920
62 T A -0.5433
63 G A -0.8808
64 V A -0.8371
65 P A -1.1849
66 D A -2.2926
67 R A -2.0907
68 F A 0.0000
69 S A -1.4239
70 G A -0.9426
71 S A -0.9736
72 G A -1.1676
73 S A -1.1286
74 G A -0.9880
75 T A -1.6275
76 D A -2.2473
77 F A 0.0000
78 T A -1.2608
79 L A 0.0000
80 K A -2.2073
81 I A 0.0000
82 S A -2.3855
83 R A -3.2706
84 V A 0.0000
85 E A -2.3603
86 A A -1.7001
87 E A -2.3772
88 D A 0.0000
89 V A -1.0414
90 G A 0.0000
91 V A -0.2501
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A -0.0013
99 S A -0.0740
100 Y A -0.1277
101 P A -0.7743
102 F A 0.0000
103 T A -0.0313
104 F A 0.0724
105 G A 0.0000
106 Q A -1.0864
107 G A 0.0000
108 T A 0.0000
109 K A -0.7184
110 L A 0.0000
111 E A -1.8411
112 I A -1.7024
113 K A -2.4393
114 G A -1.8226
115 G A -1.7256
116 G A -1.3537
117 G A -1.4774
118 S A -1.0835
119 G A -1.5774
120 G A -1.5228
121 G A -1.7186
122 G A -1.5474
123 S A -1.1126
124 G A -1.2279
125 G A -1.2215
126 G A -1.3416
127 G A -1.3882
128 S A -1.3278
129 Q A -1.7884
130 V A 0.0000
131 Q A -1.5780
132 L A 0.0000
133 V A -0.0721
134 Q A 0.0000
135 S A -0.5317
136 G A -0.4663
137 A A 0.3184
138 E A 0.0642
139 V A 1.0407
140 K A -0.9251
141 K A -2.1147
142 P A -2.1341
143 G A -1.4749
144 A A -1.1700
145 S A -1.3224
146 V A 0.0000
147 K A -2.0597
148 V A 0.0000
149 S A -0.6706
150 C A 0.0000
151 K A -0.9610
152 A A 0.0000
153 S A -0.8638
154 G A -0.9466
155 Y A -0.4580
156 T A -0.3052
157 F A 0.0000
158 N A -1.1577
159 S A -0.3175
160 Y A 0.1583
161 W A 0.3583
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A 0.0000
167 Q A -0.5065
168 A A -0.8966
169 P A -0.9099
170 G A -1.2113
171 Q A -1.8482
172 G A -1.2741
173 L A 0.0000
174 E A -0.7157
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.1738
181 P A 0.0000
182 S A -0.7276
183 D A -0.6952
184 S A -0.1401
185 Y A 1.0202
186 T A 0.5141
187 N A -0.0075
188 Y A -1.2154
189 N A -1.9878
190 Q A -2.9715
191 K A -3.0771
192 F A 0.0000
193 K A -3.5699
194 D A -3.2681
195 R A -2.2859
196 V A 0.0000
197 T A -1.1203
198 M A 0.0000
199 T A -0.3578
200 R A -1.2166
201 D A -1.1275
202 T A -0.8713
203 S A -0.5594
204 T A -0.6589
205 S A -0.8707
206 T A 0.0000
207 V A 0.0000
208 Y A -0.7809
209 M A 0.0000
210 E A -1.6087
211 L A 0.0000
212 S A -1.2795
213 S A -1.2008
214 L A 0.0000
215 R A -2.7699
216 S A -2.2518
217 E A -2.4751
218 D A 0.0000
219 T A -0.6743
220 A A 0.0000
221 V A 0.5508
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A 0.1378
229 R A -0.7317
230 G A 0.0000
231 N A 0.0000
232 S A 0.0000
233 F A 0.0000
234 D A -0.1808
235 Y A -0.1179
236 W A -0.3395
237 G A 0.0000
238 Q A -1.2370
239 G A -0.3589
240 T A 0.0000
241 L A 1.0692
242 V A 0.0000
243 T A -0.0578
244 V A 0.0000
245 S A -1.0696
246 S A -1.1607
1 D B -2.0620
2 Q B -1.5625
3 W B -0.0196
4 S B -0.8604
5 T B -0.8591
6 Q B -1.4780
7 D B -1.4719
8 L B -0.3421
9 Y B 0.5742
10 N B 0.0704
11 N B -0.1451
12 P B 0.0000
13 V B -0.3530
14 T B -0.2927
15 A B 0.1338
16 V B 0.6960
17 F B 0.5735
18 N B -0.7558
19 Y B -0.7304
20 Q B -1.3657
21 G B -1.0101
22 L B 0.3905
23 W B 0.4930
24 R B 0.1328
25 S B -0.4494
26 C B 0.0000
27 V B -0.9449
28 R B -1.4775
29 E B 0.0000
30 S B -0.0985
31 S B 0.0000
32 G B -0.4610
33 F B -0.5043
34 T B -1.5384
35 E B -2.4655
36 C B -1.5383
37 R B -1.5726
38 G B 0.2032
39 Y B 1.9449
40 F B 3.0410
41 T B 2.0465
42 L B 2.9550
43 L B 2.5870
44 G B 1.0709
45 L B 1.0792
46 P B 0.3736
47 A B 0.3108
48 M B 1.2048
49 L B 0.5803
50 Q B -0.7099
51 A B 0.2466
52 V B 0.8643
53 R B -1.1561
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.409 5.5371 View CSV PDB
4.5 -0.447 5.5371 View CSV PDB
5.0 -0.4924 5.5371 View CSV PDB
5.5 -0.5375 5.5371 View CSV PDB
6.0 -0.5736 5.5371 View CSV PDB
6.5 -0.5936 5.5371 View CSV PDB
7.0 -0.5966 5.5371 View CSV PDB
7.5 -0.5878 5.5371 View CSV PDB
8.0 -0.5721 5.537 View CSV PDB
8.5 -0.5508 5.5367 View CSV PDB
9.0 -0.5243 5.5358 View CSV PDB