Project name: d038ef6b414a6a4

Status: done

Started: 2025-02-21 07:14:02
Chain sequence(s) A: MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSSRTKPEQVDTVRRSREHMRSREESELKQFGDAGGSSNEAANKRQGRASQNNSYDNKSPLHKNSYDGTGKSRPKPTNLRADESPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSGANVSGSSRTPTHQSSRNPNNTSSCCCFGFGGK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-4.3279
Maximal score value
2.6396
Average score
-1.424
Total score value
-300.4583

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5845
2 A A -0.5386
3 R A -1.7409
4 S A -1.2428
5 N A -1.2548
6 V A 0.6394
7 P A -0.1420
8 K A -0.9157
9 F A 0.9273
10 G A -0.5493
11 N A -1.7242
12 W A -0.8316
13 E A -2.6777
14 A A -2.3891
15 E A -3.2907
16 E A -3.2816
17 N A -2.2582
18 V A -0.5098
19 P A 0.4956
20 Y A 1.7528
21 T A 0.9426
22 A A 0.4398
23 Y A 1.0174
24 F A 0.6238
25 D A -1.5225
26 K A -2.6227
27 A A -2.0941
28 R A -3.1353
29 K A -3.5975
30 T A -2.6192
31 R A -2.7802
32 A A -1.6689
33 P A -1.5304
34 G A -1.0176
35 S A -1.0343
36 K A -0.8344
37 I A 0.9264
38 M A 0.6408
39 N A -0.8234
40 P A -1.1835
41 N A -2.0315
42 D A -1.9684
43 P A -2.4453
44 E A -2.8433
45 Y A -1.9483
46 N A -2.9115
47 S A -2.7115
48 D A -3.2042
49 S A -2.4871
50 Q A -2.4973
51 S A -2.1464
52 Q A -2.1710
53 A A -1.1502
54 P A -0.9847
55 P A -1.1496
56 H A -1.3987
57 P A -1.0463
58 P A -1.0549
59 S A -1.1451
60 S A -1.3405
61 R A -2.4565
62 T A -2.1914
63 K A -2.6673
64 P A -2.2882
65 E A -2.5551
66 Q A -1.5543
67 V A -0.1862
68 D A -0.8356
69 T A -0.1569
70 V A 0.0610
71 R A -2.2755
72 R A -3.0126
73 S A -2.9121
74 R A -3.5396
75 E A -3.0571
76 H A -2.2769
77 M A -1.0557
78 R A -2.0791
79 S A -2.1583
80 R A -3.6327
81 E A -3.9099
82 E A -3.4800
83 S A -2.2592
84 E A -2.4847
85 L A -0.5247
86 K A -1.5407
87 Q A -1.0676
88 F A 0.4693
89 G A -0.7618
90 D A -1.7109
91 A A -1.2921
92 G A -1.1005
93 G A -0.8315
94 S A -0.9337
95 S A -1.4725
96 N A -2.2894
97 E A -2.4444
98 A A -1.5885
99 A A -1.7387
100 N A -2.4853
101 K A -3.4694
102 R A -3.6805
103 Q A -3.1340
104 G A -2.3943
105 R A -2.3838
106 A A -1.4925
107 S A -1.4177
108 Q A -2.1747
109 N A -2.4490
110 N A -1.9768
111 S A -0.9196
112 Y A -0.4601
113 D A -2.0586
114 N A -2.7707
115 K A -2.8580
116 S A -1.2362
117 P A -0.2272
118 L A 0.5011
119 H A -1.4310
120 K A -2.4818
121 N A -2.1267
122 S A -1.0560
123 Y A -0.0271
124 D A -1.4908
125 G A -1.3994
126 T A -1.3424
127 G A -1.9121
128 K A -2.5042
129 S A -2.3789
130 R A -2.9506
131 P A -2.0853
132 K A -2.6245
133 P A -1.5202
134 T A -0.9891
135 N A -1.2635
136 L A -0.1289
137 R A -1.6069
138 A A -1.9271
139 D A -3.1020
140 E A -3.1138
141 S A -2.4158
142 P A -1.9307
143 E A -2.6982
144 K A -1.5909
145 V A 1.1585
146 T A 1.1683
147 V A 2.5985
148 V A 2.6181
149 P A 0.6833
150 K A -0.6880
151 F A 0.5412
152 G A -1.0300
153 D A -2.0181
154 W A -1.2200
155 D A -2.8771
156 E A -3.3307
157 N A -2.8041
158 N A -2.1964
159 P A -1.6761
160 S A -1.3883
161 S A -1.4345
162 A A -0.7581
163 D A -1.4867
164 G A -0.5735
165 Y A 1.1460
166 T A 0.3282
167 H A -0.1792
168 I A 1.6587
169 F A 1.4294
170 N A -1.2410
171 K A -2.4569
172 V A -1.6019
173 R A -3.5919
174 E A -4.3279
175 E A -4.2708
176 R A -4.2673
177 S A -3.0875
178 S A -2.5908
179 G A -1.6712
180 A A -0.9712
181 N A -0.8088
182 V A 0.5988
183 S A 0.0239
184 G A -0.6452
185 S A -0.8993
186 S A -1.4245
187 R A -2.1784
188 T A -1.3484
189 P A -1.2966
190 T A -1.3711
191 H A -1.7752
192 Q A -2.1706
193 S A -1.8440
194 S A -2.0792
195 R A -3.0206
196 N A -2.8917
197 P A -2.2857
198 N A -2.6196
199 N A -2.2368
200 T A -1.1774
201 S A -0.4727
202 S A 0.0719
203 C A 1.0971
204 C A 1.7665
205 C A 2.3176
206 F A 2.6396
207 G A 1.5500
208 F A 1.7087
209 G A 0.0384
210 G A -1.0591
211 K A -1.8237
Download PDB file
View in 3Dmol