Project name: AlaAla_R?

Status: done

Started: 2026-08-20 08:49:54
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d03e9acbe0b0694/tmp/folded.pdb                (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:28)
Show buried residues

Minimal score value
-2.5933
Maximal score value
2.3224
Average score
-0.5381
Total score value
-133.4589

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.7019
2 V A 0.0000
3 Q A -2.0581
4 L A 0.0000
5 Q A -1.8574
6 E A 0.0000
7 S A -0.6367
8 G A -0.2991
9 P A 0.1234
10 G A 0.5223
11 L A 1.0566
12 V A 0.0000
13 K A -1.8330
14 P A -1.3198
15 S A -1.4018
16 Q A -1.9510
17 T A -1.5856
18 L A 0.0000
19 S A -0.9993
20 L A 0.0000
21 T A -0.6368
22 A A 0.0000
23 T A -1.2510
24 V A 0.0000
25 S A -1.3942
26 G A -1.4303
27 G A -1.1068
28 S A -0.6857
29 I A 0.0000
30 S A -0.3334
31 S A -0.3214
32 G A -0.3689
33 D A -0.0432
34 Y A 0.6031
35 Y A 0.5444
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6674
43 P A -0.6277
44 G A -1.1426
45 C A -1.2260
46 K A -2.0149
47 G A -1.2068
48 L A 0.0000
49 E A -0.7219
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1467
54 I A 0.0000
55 Y A 0.2292
56 Y A 0.1425
57 S A -0.1848
58 G A -0.2597
59 S A -0.2980
60 T A -0.2736
61 D A -0.7062
62 Y A -0.6972
63 N A -0.9136
64 P A -1.1944
65 S A -1.1198
66 L A 0.0000
67 K A -2.0867
68 S A -1.3900
69 R A -1.6100
70 V A 0.0000
71 T A -1.1127
72 M A 0.0000
73 S A -0.3842
74 V A -0.3999
75 D A -1.2302
76 T A -1.0668
77 S A -1.3381
78 K A -2.1806
79 N A -1.4817
80 Q A -1.3000
81 F A 0.0000
82 S A -0.5542
83 L A 0.0000
84 K A -1.6223
85 V A 0.0000
86 N A -1.6586
87 S A -1.4896
88 V A 0.0000
89 T A -0.6631
90 A A -0.2927
91 A A -0.0269
92 D A 0.0000
93 T A 0.3493
94 A A 0.0000
95 V A 0.0000
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.9100
103 I A 1.6121
104 F A 2.3224
105 G A 1.4935
106 V A 1.7900
107 G A 0.0000
108 T A 0.0000
109 F A 0.0000
110 D A -0.6194
111 Y A -0.6600
112 W A -0.8744
113 G A 0.0000
114 Q A -1.6016
115 G A -0.6701
116 T A 0.0349
117 L A 1.3494
118 V A 0.0000
119 T A 0.4583
120 V A 0.0000
121 S A -0.3718
122 S A -0.6414
123 A A -0.6987
124 A A -0.3560
125 G A -0.8407
126 G A -1.0811
127 G A -1.1238
128 G A -1.1728
129 S A -1.0364
130 G A -1.1643
131 G A -1.2364
132 G A -1.2059
133 G A -1.2493
134 S A -1.0905
135 G A -1.2397
136 G A -1.3397
137 G A -1.2699
138 G A -1.2511
139 S A -0.9428
140 D A -0.9779
141 I A -0.1560
142 V A 0.9995
143 M A 0.0000
144 T A -0.6058
145 Q A -0.8406
146 S A -0.7195
147 P A -0.3384
148 A A -0.3622
149 T A -0.4814
150 L A -0.2262
151 S A -0.3746
152 L A -0.7012
153 S A -1.0308
154 P A -1.5397
155 G A -1.8277
156 E A -2.4269
157 R A -2.5933
158 A A 0.0000
159 T A -0.6661
160 L A 0.0000
161 S A -0.9082
162 A A 0.0000
163 R A -2.3967
164 A A 0.0000
165 S A -0.9003
166 Q A -1.6108
167 S A -1.2965
168 V A 0.0000
169 S A -0.5974
170 S A -0.3857
171 Y A 0.4528
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3938
179 P A -0.8464
180 G A -0.9395
181 C A -1.1201
182 Q A -1.5386
183 A A -1.1928
184 P A 0.0000
185 R A -1.5412
186 L A -0.7076
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1311
190 D A -0.3928
191 A A 0.0000
192 S A -0.9360
193 N A -1.2839
194 R A -1.4660
195 A A -0.9639
196 T A -0.6700
197 G A -0.6660
198 I A 0.0000
199 P A -0.4377
200 A A -0.3818
201 R A -0.7167
202 F A 0.0000
203 S A -0.7007
204 G A -0.6957
205 S A -0.8262
206 G A -1.1740
207 S A -1.0514
208 G A -1.1652
209 T A -1.8444
210 D A -2.3312
211 F A 0.0000
212 T A -0.8137
213 L A 0.0000
214 T A -0.6000
215 I A 0.0000
216 S A -1.3623
217 S A -1.7553
218 L A 0.0000
219 E A -2.1716
220 P A -1.5575
221 E A -2.3722
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6465
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0132
233 S A -0.2030
234 T A -0.4350
235 P A -0.3135
236 L A 0.0000
237 T A 0.1598
238 F A 0.2487
239 G A 0.0000
240 G A -0.8042
241 G A -0.7671
242 T A 0.0000
243 K A -0.9124
244 A A 0.0000
245 E A -0.5371
246 I A 0.6522
247 K A -0.8928
248 A A -0.3543
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5199 4.7903 View CSV PDB
4.5 -0.5405 4.7881 View CSV PDB
5.0 -0.5641 4.7821 View CSV PDB
5.5 -0.5853 4.7689 View CSV PDB
6.0 -0.5977 4.7473 View CSV PDB
6.5 -0.5967 4.7199 View CSV PDB
7.0 -0.5829 4.69 View CSV PDB
7.5 -0.561 4.6592 View CSV PDB
8.0 -0.5346 4.6281 View CSV PDB
8.5 -0.5048 4.597 View CSV PDB
9.0 -0.4721 4.5661 View CSV PDB