Project name: RFA94_protenix

Status: done

Started: 2026-06-15 02:22:08
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFDTYYFGWVRQAPGKGLEWVSSISRQGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCALMRRAGGPNSIGWIGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSSVPTSAIGWYLQKSGQSPQLLIYAVDKRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQGSFLPGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d13fed6e096a724/tmp/folded.pdb                (00:03:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:17)
Show buried residues

Minimal score value
-3.2702
Maximal score value
1.8674
Average score
-0.7207
Total score value
-170.0865

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.6517
2 V A -0.3009
3 Q A -0.7580
4 L A 0.0000
5 V A 0.3255
6 E A 0.0000
7 S A -0.6357
8 G A -1.0157
9 G A -0.6432
10 G A -0.1568
11 L A 0.3279
12 E A -0.9233
13 Q A -1.7422
14 P A -1.6752
15 G A -1.4308
16 G A -1.0877
17 S A -1.2220
18 L A -1.1488
19 R A -2.2582
20 L A 0.0000
21 S A -0.5453
22 C A 0.0000
23 A A -0.3480
24 G A 0.0000
25 S A -0.6274
26 G A -0.8296
27 F A -0.3732
28 T A -0.4150
29 F A 0.0000
30 D A -2.4597
31 T A -1.1456
32 Y A -1.0742
33 Y A -0.9129
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.9602
40 A A -1.3038
41 P A -1.0393
42 G A -1.4765
43 K A -2.4294
44 G A -1.6173
45 L A 0.0000
46 E A -1.2576
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -1.3139
53 R A -2.5554
54 Q A -2.5132
55 G A -1.6980
56 S A -1.0749
57 G A -0.8305
58 T A -0.3468
59 Y A 0.0818
60 Y A -0.6216
61 A A -1.2120
62 D A -2.4268
63 S A -1.7146
64 V A 0.0000
65 K A -2.4888
66 G A -1.6307
67 R A 0.0000
68 F A 0.0000
69 T A -0.8724
70 I A 0.0000
71 S A -0.6625
72 R A -1.5712
73 D A -1.9328
74 N A -2.4991
75 S A -1.8075
76 K A -2.5345
77 N A -2.0248
78 T A -1.2444
79 L A 0.0000
80 Y A -0.6549
81 L A 0.0000
82 Q A -1.5305
83 M A 0.0000
84 N A -1.3025
85 S A -1.1083
86 L A 0.0000
87 R A -2.1839
88 A A -1.7076
89 E A -2.1754
90 D A 0.0000
91 T A -0.7507
92 A A 0.0000
93 V A -0.0361
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 L A 0.0000
99 M A 0.0000
100 R A -1.9289
101 R A -1.8585
102 A A 0.0000
103 G A -0.1483
104 G A -0.4618
105 P A -0.7918
106 N A -1.2234
107 S A -0.1412
108 I A 0.9305
109 G A 0.0000
110 W A -0.2125
111 I A 0.0000
112 G A 0.0000
113 D A -0.9224
114 V A -0.1234
115 W A 0.0000
116 G A 0.0000
117 Q A -1.3718
118 G A -0.6968
119 T A -0.3351
120 T A -0.0554
121 V A 0.0000
122 T A -0.3914
123 V A 0.0000
124 S A -0.9851
125 S A -0.8381
126 A A -0.3400
127 S A -0.3995
1 D B -0.7770
2 I B 0.7047
3 V B 1.0235
4 M B 0.0000
5 T B -0.5963
6 Q B 0.0000
7 S B -0.4288
8 P B -0.0445
9 L B 0.4312
10 S B -0.1256
11 L B -0.2832
12 P B -1.1785
13 V B 0.0000
14 T B -1.7310
15 P B -2.0910
16 G B -2.1773
17 E B -2.9048
18 P B -2.4291
19 A B 0.0000
20 S B -0.8483
21 I B 0.0000
22 S B -1.0669
23 C B 0.0000
24 R B -2.1904
25 S B 0.0000
26 S B -0.1911
27 V B 0.1776
28 P B -0.5981
29 T B 0.0000
30 S B -0.1801
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -0.8739
38 K B -1.4998
39 S B -0.9558
40 G B -1.4619
41 Q B -2.0674
42 S B -1.4223
43 P B 0.0000
44 Q B -1.2436
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -1.1504
49 A B -0.8685
50 V B -1.2648
51 D B -2.5771
52 K B -2.4467
53 R B -2.1247
54 G B -1.2212
55 S B -0.7885
56 G B -0.8533
57 V B -1.0906
58 P B -1.2487
59 D B -2.1415
60 R B -2.0982
61 F B 0.0000
62 S B -1.9575
63 G B 0.0000
64 S B -1.5141
65 G B -1.3783
66 S B -1.0813
67 G B -1.0274
68 T B -1.4330
69 D B -2.2035
70 F B 0.0000
71 T B -1.3734
72 L B 0.0000
73 K B -1.9972
74 I B 0.0000
75 S B -2.4585
76 R B -3.2702
77 V B 0.0000
78 E B -2.4551
79 A B -1.3909
80 E B -2.1672
81 D B 0.0000
82 V B -0.6043
83 G B -0.5520
84 F B 0.2136
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B 0.0000
91 S B 1.0908
92 F B 1.8351
93 L B 1.8674
94 P B 0.6481
95 G B 0.0000
96 T B 0.2572
97 F B -0.0125
98 G B 0.0000
99 Q B -1.0781
100 G B 0.0000
101 T B 0.0000
102 K B -0.5732
103 L B 0.0000
104 E B -1.5403
105 I B -1.6115
106 K B -1.9430
107 R B -2.0889
108 T B -0.4081
109 V B 1.0759
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.635 3.7218 View CSV PDB
4.5 -0.6837 3.6754 View CSV PDB
5.0 -0.7423 3.6164 View CSV PDB
5.5 -0.8019 3.5516 View CSV PDB
6.0 -0.853 3.4847 View CSV PDB
6.5 -0.8874 3.4171 View CSV PDB
7.0 -0.9034 3.3495 View CSV PDB
7.5 -0.9061 3.2823 View CSV PDB
8.0 -0.9009 3.2165 View CSV PDB
8.5 -0.8888 3.1547 View CSV PDB
9.0 -0.8682 3.1029 View CSV PDB