Project name: ok 16

Status: done

Started: 2026-03-17 06:59:49
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASQSVSYMNWYKQKPGLAPRLLIYDTSNLAYGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSNNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:17)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:18)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:19)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:35)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d1d496cf430eb7/tmp/folded.pdb                 (00:04:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:52)
Show buried residues

Minimal score value
-3.6519
Maximal score value
1.3187
Average score
-0.7124
Total score value
-170.268

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9591
2 I A 0.0000
3 V A 0.8752
4 L A 0.0000
5 T A -0.3002
6 K A -0.5747
7 S A -0.5221
8 P A -0.4086
9 A A -0.5879
10 T A -0.4982
11 L A -0.4014
12 S A -0.7651
13 L A -1.0892
14 S A -1.6523
15 P A -1.9510
16 G A -2.2891
17 E A -2.9053
18 R A -3.2569
19 A A 0.0000
20 T A -0.5423
21 L A 0.0000
22 S A -0.7108
23 C A 0.0000
24 S A -0.9580
25 A A 0.0000
26 S A -0.7044
27 Q A -1.6432
28 S A -1.3760
29 V A 0.0000
30 S A -0.5918
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3619
37 Q A 0.0000
38 K A -0.7600
39 P A -0.2402
40 G A -0.0749
41 L A 0.7226
42 A A 0.0673
43 P A 0.0000
44 R A -0.4328
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.0739
49 D A -0.7918
50 T A -0.6331
51 S A -0.5883
52 N A -0.3170
53 L A 0.1804
54 A A 0.0000
55 Y A 1.2344
56 G A 0.0191
57 I A -0.0279
58 P A -0.7745
59 D A -1.8842
60 R A -1.9027
61 F A 0.0000
62 S A -0.6768
63 G A 0.0000
64 S A -0.8986
65 G A -1.1617
66 S A -1.0962
67 G A -1.2202
68 T A -1.5808
69 D A -2.2682
70 F A 0.0000
71 T A -0.7429
72 L A 0.0000
73 T A -0.7979
74 I A 0.0000
75 S A -2.3892
76 R A -3.3424
77 L A 0.0000
78 E A -2.6107
79 P A -1.8964
80 E A -2.7042
81 D A 0.0000
82 F A 0.0000
83 A A 0.0000
84 V A -0.6744
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.3539
91 S A -0.6403
92 N A -1.9102
93 N A -2.0786
94 P A -1.7482
95 F A 0.0000
96 T A 0.0000
97 F A 0.1905
98 G A 0.0000
99 Q A -1.3689
100 G A 0.0000
101 T A 0.0000
102 K A -1.2486
103 L A 0.0000
104 E A -1.1436
105 I A -1.0070
106 K A -1.9439
107 G A -1.5050
108 G A -1.3051
109 G A -1.2348
110 G A -1.5371
111 S A -1.0487
112 G A -1.6832
113 G A -1.5818
114 G A -1.5621
115 G A -1.5175
116 S A -1.0892
117 G A -1.2680
118 G A -1.2082
119 G A -1.3371
120 G A -1.3984
121 S A -1.1673
122 Q A -1.7637
123 V A 0.0000
124 Q A -1.3956
125 L A 0.0000
126 V A 0.1733
127 Q A 0.0000
128 S A -0.5721
129 G A -0.6489
130 A A -0.0965
131 E A -0.1853
132 V A 0.8681
133 Q A -0.8953
134 K A -2.1574
135 P A -2.2858
136 G A -1.6288
137 A A -1.2703
138 S A -1.3232
139 V A 0.0000
140 K A -1.7032
141 V A 0.0000
142 S A -0.5647
143 C A 0.0000
144 K A -0.8402
145 A A 0.0000
146 S A -0.8010
147 G A -0.9397
148 Y A -0.7100
149 T A -0.7983
150 F A 0.0000
151 N A -2.1480
152 R A -2.4111
153 Y A -1.2644
154 T A -0.6189
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1668
160 Q A -0.3452
161 A A -0.7714
162 P A -0.7822
163 G A -1.1870
164 Q A -1.1732
165 L A 0.0000
166 L A -0.2159
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.5058
171 I A 0.0000
172 N A -0.5620
173 P A 0.0000
174 S A -1.7353
175 R A -1.5860
176 G A -0.4428
177 Y A 1.1010
178 Y A 1.3187
179 N A -0.2344
180 Y A -1.3368
181 A A 0.0000
182 Q A -3.0160
183 K A -3.0310
184 F A 0.0000
185 K A -3.6519
186 D A -3.2776
187 R A -2.3037
188 V A 0.0000
189 T A -0.9514
190 M A 0.0000
191 T A -0.2733
192 R A -1.4224
193 D A -1.2611
194 T A -0.9271
195 S A -0.5880
196 T A -0.6719
197 S A -0.8891
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7465
201 M A 0.0000
202 E A -1.3707
203 L A 0.0000
204 S A -1.3112
205 S A -1.4169
206 L A 0.0000
207 R A -3.1445
208 S A -2.4163
209 E A -2.5644
210 D A 0.0000
211 T A -0.9238
212 A A -0.3141
213 V A 0.0772
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0836
221 D A -2.4552
222 D A -2.4731
223 H A -1.2801
224 Y A -0.4754
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.0165
229 W A 0.0002
230 G A 0.0000
231 Q A -0.7502
232 G A -0.2501
233 T A 0.0000
234 T A -0.0370
235 V A 0.0000
236 T A -0.3611
237 V A 0.0000
238 S A -0.8869
239 S A -1.0002
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6861 1.8983 View CSV PDB
4.5 -0.7293 1.9034 View CSV PDB
5.0 -0.7788 1.9174 View CSV PDB
5.5 -0.8262 1.9484 View CSV PDB
6.0 -0.8633 1.9994 View CSV PDB
6.5 -0.8847 2.0642 View CSV PDB
7.0 -0.8907 2.1352 View CSV PDB
7.5 -0.8864 2.2083 View CSV PDB
8.0 -0.8757 2.2819 View CSV PDB
8.5 -0.8591 2.3549 View CSV PDB
9.0 -0.8354 2.4252 View CSV PDB