Project name: d28ccd0a30bc077

Status: done

Started: 2026-03-12 18:49:18
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGSSGGEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:03)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d28ccd0a30bc077/tmp/folded.pdb                (00:03:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:21)
Show buried residues

Minimal score value
-3.9085
Maximal score value
3.6923
Average score
-0.6391
Total score value
-150.1982

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1735
2 H A -1.3772
3 H A -2.1242
4 H A -2.5437
5 H A -2.6441
6 H A -2.5877
7 H A -2.2779
8 F A -1.7945
9 D A -2.5969
10 A A -2.0566
11 S A -2.1156
12 N A -2.5057
13 F A 0.0000
14 K A -2.3361
15 D A -1.3678
16 F A -0.6088
17 S A -0.6877
18 S A -1.2501
19 I A 0.0000
20 A A -0.4741
21 S A -0.5894
22 A A -1.0312
23 S A -0.6761
24 S A 0.0000
25 S A -0.2108
26 W A 0.0000
27 Q A -1.2671
28 N A 0.0000
29 Q A -1.8762
30 S A -1.3730
31 G A -1.2874
32 S A 0.0000
33 T A -0.8787
34 M A 0.0000
35 I A -0.1755
36 I A 0.0000
37 Q A -1.5173
38 V A 0.0000
39 D A -0.7900
40 S A 0.3136
41 F A 1.0958
42 G A 0.0000
43 N A -1.1250
44 V A 0.0000
45 S A -1.1677
46 G A -0.7496
47 Q A -0.7915
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -2.4176
52 A A -1.8102
53 Q A -1.8958
54 G A -1.3357
55 T A -1.0368
56 G A -1.2889
57 C A 0.0000
58 Q A -2.0583
59 N A -1.9898
60 S A -1.3814
61 P A -1.0360
62 Y A 0.0000
63 P A -0.8776
64 L A 0.0000
65 T A -0.9412
66 G A 0.0000
67 R A -1.9654
68 V A 0.0000
69 N A -1.0602
70 G A -0.6157
71 T A -0.0395
72 F A 0.9052
73 I A 0.0000
74 A A -0.4266
75 F A 0.0000
76 S A -0.6403
77 V A 0.0000
78 G A -1.1791
79 W A 0.0000
80 N A -2.6316
81 N A -1.7240
82 S A -1.1413
83 T A -1.3444
84 E A -2.1560
85 N A -2.7111
86 C A -1.8525
87 N A -2.2635
88 S A -1.2893
89 A A -0.5393
90 T A 0.0000
91 G A -0.6023
92 W A 0.0000
93 T A -0.0199
94 G A 0.8215
95 Y A 1.4535
96 A A 0.0000
97 Q A -0.7853
98 V A -1.3412
99 N A -1.5342
100 G A -1.5318
101 N A -2.1412
102 N A -1.7377
103 T A 0.0000
104 E A -0.7694
105 I A 0.0000
106 V A 0.3747
107 T A 0.0000
108 S A -0.8220
109 W A -1.2042
110 N A -1.1077
111 L A 0.0000
112 A A -0.1597
113 Y A -0.5670
114 E A -1.8789
115 G A -1.0570
116 G A -1.0742
117 S A -0.9177
118 G A -1.0725
119 P A -0.8106
120 A A 0.0041
121 I A 0.9243
122 E A -0.6323
123 Q A -1.7052
124 G A -1.6514
125 Q A -1.7574
126 D A -1.1984
127 T A -0.8024
128 F A 0.0000
129 Q A -1.1987
130 Y A 0.0000
131 V A 0.2994
132 P A -0.5005
133 T A -0.7964
134 T A -1.5348
135 E A -3.0966
136 N A -2.8578
137 K A -2.3513
138 S A -0.6321
139 L A 0.7408
140 L A 0.6671
141 K A -1.4810
142 D A -2.2102
143 T A -1.5652
144 G A -1.6221
145 G A -1.1907
146 S A -0.8593
147 S A -1.1398
148 G A -1.4006
149 G A -1.9990
150 E A -2.5097
151 P A -1.8208
152 R A -2.0896
153 I A -0.5331
154 Q A -1.9957
155 K A -2.3290
156 E A -1.5551
157 Y A 0.6422
158 Y A 1.7705
159 Y A 1.7553
160 N A 0.1642
161 L A 0.2467
162 H A -1.7662
163 E A -2.9776
164 N A -3.0600
165 N A -2.9065
166 S A -2.1913
167 Q A -2.2640
168 A A -1.8414
169 N A -2.6766
170 H A -2.5849
171 N A -2.5833
172 K A -2.3119
173 F A -0.1906
174 H A -1.3074
175 E A -1.8077
176 M A -0.2516
177 P A -1.1388
178 E A -2.0105
179 Y A -0.9019
180 D A -2.6939
181 D A -2.8495
182 Q A -2.2397
183 L A -0.4899
184 P A -0.6404
185 D A -1.0545
186 F A 0.5449
187 P A -1.0256
188 H A -1.8388
189 K A -2.4013
190 Q A -2.3482
191 L A -1.3230
192 E A -3.2231
193 E A -3.8453
194 E A -3.9085
195 Q A -3.4278
196 N A -2.3306
197 P A -0.8394
198 F A 0.5939
199 H A -1.1685
200 K A -1.2252
201 L A 1.1036
202 S A -0.0250
203 E A -1.2301
204 V A 0.7977
205 L A 1.1773
206 N A -0.5673
207 S A -0.3850
208 G A 0.2616
209 S A 0.8528
210 V A 2.5709
211 V A 3.5341
212 P A 2.9947
213 L A 3.5718
214 W A 3.4802
215 L A 3.6343
216 V A 3.6633
217 N A 2.5307
218 P A 3.0385
219 I A 3.6923
220 Y A 3.3647
221 Y A 3.0198
222 V A 3.2003
223 L A 3.0158
224 E A 0.8383
225 L A 1.6060
226 F A 2.3013
227 P A 0.8469
228 R A -0.1446
229 A A 1.5020
230 I A 2.6186
231 S A 1.5806
232 Y A 2.1001
233 Y A 2.7271
234 F A 2.6823
235 N A 0.6554
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1589 6.1239 View CSV PDB
4.5 -0.2332 6.1239 View CSV PDB
5.0 -0.3202 6.1239 View CSV PDB
5.5 -0.3992 6.1239 View CSV PDB
6.0 -0.451 6.1239 View CSV PDB
6.5 -0.4688 6.1239 View CSV PDB
7.0 -0.4624 6.1238 View CSV PDB
7.5 -0.4465 6.1238 View CSV PDB
8.0 -0.4266 6.1237 View CSV PDB
8.5 -0.4019 6.1234 View CSV PDB
9.0 -0.3716 6.1226 View CSV PDB