Project name: KNL1 [mutate: AV2165A]

Status: done

Started: 2026-03-30 01:59:06
Chain sequence(s) A: RTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Mutated residues AV2165A
Energy difference between WT (input) and mutated protein (by FoldX) 1.62789 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:02:45)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:49)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:27:25)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:27:26)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:27:26)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:27:27)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:27:28)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:27:28)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:27:29)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:27:30)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:27:31)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:27:31)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:27:32)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:27:33)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:27:34)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:27:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:27:37)
Show buried residues

Minimal score value
-2.319
Maximal score value
2.1388
Average score
-0.2444
Total score value
-52.31

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
2096 R A -1.9738
2097 T A -0.7422
2098 E A -2.0085
2099 E A -1.4680
2100 L A 0.2977
2101 L A 1.2522
2102 D A -1.5169
2103 Q A 0.0000
2104 L A 0.3426
2105 S A -0.1949
2106 L A 0.2722
2107 S A -0.0351
2108 E A 0.0000
2109 W A 0.6568
2110 D A -1.0620
2111 V A 0.6712
2112 V A 1.5509
2113 E A -1.3207
2114 W A 0.0580
2115 S A -0.4597
2116 D A -1.9903
2117 D A -1.5359
2118 Q A -1.2764
2119 A A 0.0000
2120 V A 0.4005
2121 F A 0.0000
2122 T A -0.2558
2123 F A 0.0000
2124 V A 0.6703
2125 Y A 0.0000
2126 D A 0.0000
2127 T A 0.0797
2128 I A 0.0000
2129 Q A -0.7065
2130 L A 0.0000
2131 T A 0.0412
2132 I A 0.0000
2133 T A -0.0706
2134 F A 0.2794
2135 E A -1.2519
2136 E A -2.0157
2137 S A -0.3675
2138 V A 0.4616
2139 V A 1.3279
2140 G A 0.2645
2141 F A 1.8214
2142 P A 0.4651
2143 F A 2.1388
2144 L A 1.5843
2145 D A -0.4039
2146 K A 0.0000
2147 R A -1.4299
2148 Y A 0.9566
2149 R A 0.0000
2150 K A -0.9730
2151 I A 0.0000
2152 V A 0.1566
2153 D A -1.1854
2154 V A 0.0000
2155 N A -0.4697
2156 F A -0.0455
2157 Q A -1.1394
2158 S A -0.1427
2159 L A 1.5444
2160 L A 0.8265
2161 D A -1.7964
2162 E A -1.6257
2163 D A -2.0247
2164 Q A -0.5818
2165 V A 0.2069 mutated: AV2165A
2166 P A -0.2493
2167 P A -0.3113
2168 S A -0.0684
2169 S A 0.0000
2170 L A 0.3328
2171 L A 0.0000
2172 V A 0.0000
2173 H A 0.0000
2174 K A -1.7000
2175 L A 0.0000
2176 I A 0.0000
2177 F A 1.1412
2178 Q A -0.4951
2179 Y A 0.0537
2180 V A 0.0000
2181 E A -2.2344
2182 E A -2.3190
2183 K A -1.2760
2184 E A -0.9367
2185 S A -0.0875
2186 W A -0.0583
2187 K A -1.6313
2188 K A -1.9622
2189 T A -0.2726
2190 C A 0.6378
2191 T A 0.1054
2192 T A -0.1565
2193 Q A 0.0000
2194 H A -1.1073
2195 Q A -0.8106
2196 L A 0.0000
2197 P A 0.0000
2198 K A -1.4924
2200 L A 0.0000
2201 E A -0.6552
2202 E A -1.1819
2203 F A 0.0000
2204 S A 0.0000
2205 L A 0.7054
2206 V A 0.3027
2207 V A 0.0000
2208 H A 0.0000
2209 H A -0.1859
2210 C A 0.0000
2211 R A -0.3463
2212 L A 0.0000
2213 L A 0.0000
2214 G A 0.0000
2215 E A -0.2062
2216 E A 0.0000
2217 I A 0.0000
2218 E A -0.3117
2219 Y A 0.9231
2220 L A 0.0000
2221 K A -0.9730
2222 R A -1.6678
2223 W A 0.5173
2224 G A 0.0971
2225 P A -0.4444
2226 N A -1.0035
2227 Y A 0.0000
2228 N A -0.1778
2229 L A 0.0236
2231 N A -1.2264
2232 I A 0.0000
2233 D A -0.6991
2234 I A -0.0241
2235 N A -1.0420
2236 N A -1.3699
2237 N A -1.0923
2238 E A -0.6692
2239 L A 0.0000
2240 R A -0.6111
2241 L A 0.0000
2242 L A 0.1852
2243 F A 0.0000
2244 S A -0.1647
2245 S A 0.0000
2246 S A -0.3870
2247 A A 0.0295
2248 A A 0.4433
2249 F A 1.9523
2250 A A 0.0000
2251 K A -0.7670
2252 F A 0.0000
2253 E A -0.2920
2254 I A 0.0000
2255 T A 0.0000
2256 L A 0.0000
2257 F A 1.6430
2258 L A 0.0000
2259 S A -0.0549
2260 A A 0.0000
2261 Y A 0.9395
2262 Y A 0.0000
2263 P A -0.0119
2264 S A -0.0988
2265 V A 0.6323
2266 P A 0.0000
2267 L A 0.0000
2268 P A -0.2352
2269 S A -0.0792
2270 T A 0.0778
2271 I A 0.4558
2272 Q A -0.7129
2273 N A -0.8092
2274 H A -0.8510
2275 V A 1.0356
2276 G A -0.0492
2277 N A -0.6837
2278 T A -0.1441
2279 S A -0.2733
2280 Q A -1.5503
2281 D A -2.1651
2282 D A -1.1296
2283 I A 0.0000
2284 A A -0.1880
2285 T A -0.0415
2286 I A 0.0000
2287 L A 0.0000
2288 S A -0.5357
2289 K A -1.7404
2290 V A 0.0000
2291 P A 0.0705
2292 L A 1.3119
2293 E A -0.9636
2294 N A -1.3259
2295 N A -0.7843
2296 Y A 0.0000
2297 L A 0.0000
2298 K A -0.4998
2299 N A -0.3647
2300 V A 0.0000
2301 V A 0.0000
2302 K A -0.7474
2303 Q A -0.4951
2304 I A 0.0000
2305 Y A -0.1098
2306 Q A -1.3921
2307 D A -1.3265
2308 L A 0.0000
2309 F A 1.8967
2310 Q A -0.1949
2311 D A -1.8548
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.2444 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.2444 View CSV PDB
model_5 -0.2485 View CSV PDB
model_1 -0.262 View CSV PDB
model_0 -0.2692 View CSV PDB
model_4 -0.2783 View CSV PDB
CABS_average -0.2838 View CSV PDB
model_2 -0.2848 View CSV PDB
model_8 -0.2888 View CSV PDB
model_7 -0.2922 View CSV PDB
model_10 -0.2935 View CSV PDB
model_9 -0.3089 View CSV PDB
model_6 -0.3168 View CSV PDB
model_11 -0.3181 View CSV PDB
input -0.338 View CSV PDB