Project name: 5B5 MUTANT ANTIBODY 7

Status: done

Started: 2026-03-17 05:33:05
Chain sequence(s) A: DIVMTQTPLSLSVTPGQPASISCRSSQSLVHSNGKTYLEWYLQKPGQSPQLLIYKLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGSGTKLEIKGGGGSGGGGSGGGGSVQLVQSGAEVKKPGASVKVSCKASGYTFTDYIMLWVRQAPGQGLEWMGNIDPYYGSTGYNLKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDGNYGSDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:11)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d368c930ae9aa72/tmp/folded.pdb                (00:02:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:49)
Show buried residues

Minimal score value
-3.1435
Maximal score value
1.7283
Average score
-0.6157
Total score value
-149.6037

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.0111
2 I A 0.0000
3 V A 0.7564
4 M A 0.0000
5 T A -0.2729
6 Q A 0.0000
7 T A -0.0043
8 P A 0.4346
9 L A 1.2224
10 S A 0.0666
11 L A -0.4308
12 S A -1.2462
13 V A 0.0000
14 T A -1.6227
15 P A -1.7045
16 G A -1.5577
17 Q A -1.7662
18 P A -1.9067
19 A A 0.0000
20 S A -0.8923
21 I A 0.0000
22 S A -0.9019
23 C A 0.0000
24 R A -2.2643
25 S A 0.0000
26 S A -0.9984
27 Q A -1.5607
28 S A -0.9647
29 L A 0.0000
30 V A -0.0896
31 H A -0.8556
32 S A -1.0051
33 N A -1.5745
34 G A -1.3521
35 K A -1.6416
36 T A -0.7337
37 Y A -0.2980
38 L A 0.0000
39 E A -0.0625
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A 0.0000
44 K A -1.4261
45 P A -0.9974
46 G A -1.4284
47 Q A -2.0433
48 S A -1.1911
49 P A 0.0000
50 Q A -0.8880
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A 0.0116
55 K A -0.5197
56 L A -0.3223
57 S A 0.0062
58 Y A 0.7323
59 R A -0.6962
60 A A -0.6679
61 S A -0.4479
62 G A -1.0239
63 V A 0.0000
64 P A -1.3687
65 D A -2.4059
66 R A -2.2042
67 F A 0.0000
68 S A -1.2129
69 G A -0.6829
70 S A -0.7526
71 G A -0.9788
72 S A -0.7164
73 G A -0.7416
74 T A -1.4672
75 D A -2.0584
76 F A 0.0000
77 T A -1.1453
78 L A 0.0000
79 K A -2.1380
80 I A 0.0000
81 S A -2.2345
82 R A -3.0363
83 V A 0.0000
84 E A -2.1373
85 A A -1.9184
86 E A -2.4085
87 D A 0.0000
88 V A -1.0517
89 G A 0.0000
90 V A -0.0411
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 F A 0.0000
95 Q A 0.0000
96 G A 0.2486
97 S A 0.0000
98 H A 0.2223
99 V A 1.5670
100 P A 0.0000
101 F A 0.7559
102 T A 0.4101
103 F A 0.3599
104 G A 0.0000
105 S A -0.0121
106 G A 0.0000
107 T A 0.0000
108 K A -0.5340
109 L A 0.0000
110 E A -1.9238
111 I A -1.9866
112 K A -2.4216
113 G A -1.8413
114 G A -1.7482
115 G A -1.3489
116 G A -1.4796
117 S A -1.3150
118 G A -1.5909
119 G A -1.6420
120 G A -1.6558
121 G A -1.7326
122 S A -1.0776
123 G A -1.1714
124 G A -1.1988
125 G A -1.1126
126 G A -0.8947
127 S A -0.8302
128 V A -0.6651
129 Q A -1.2795
130 L A 0.0000
131 V A 0.0077
132 Q A 0.0000
133 S A -0.6489
134 G A -0.6920
135 A A -0.1815
136 E A -0.3756
137 V A 0.7428
138 K A -1.0683
139 K A -2.2038
140 P A -2.2917
141 G A -1.6012
142 A A -1.2607
143 S A -1.3119
144 V A 0.0000
145 K A -1.7639
146 V A 0.0000
147 S A -0.6561
148 C A 0.0000
149 K A -1.1988
150 A A 0.0000
151 S A -0.7949
152 G A -0.7551
153 Y A -0.5123
154 T A -0.5977
155 F A 0.0000
156 T A -0.1328
157 D A -1.4158
158 Y A -0.6542
159 I A 0.1154
160 M A 0.0000
161 L A 0.0000
162 W A 0.0000
163 V A 0.0000
164 R A -0.3922
165 Q A -0.6469
166 A A -1.0446
167 P A -1.0457
168 G A -1.2116
169 Q A -1.6918
170 G A -0.9647
171 L A 0.0000
172 E A -0.5132
173 W A 0.0000
174 M A 0.0000
175 G A 0.0000
176 N A -0.2787
177 I A 0.0000
178 D A 0.1559
179 P A 0.0000
180 Y A 1.4182
181 Y A 1.7283
182 G A 0.4815
183 S A 0.2030
184 T A -0.0802
185 G A 0.1178
186 Y A 0.2062
187 N A 0.0000
188 L A 0.2561
189 K A -1.3716
190 F A 0.0000
191 Q A -1.4268
192 G A -1.2446
193 R A -1.2547
194 V A 0.0000
195 T A -0.7888
196 M A 0.0000
197 T A -0.6591
198 R A -0.9415
199 D A -1.2541
200 T A -0.5226
201 S A -0.5682
202 T A -0.7153
203 S A -0.8321
204 T A 0.0000
205 V A 0.0000
206 Y A -0.7901
207 M A 0.0000
208 E A -1.3884
209 L A 0.0000
210 S A -1.1272
211 S A -1.2376
212 L A 0.0000
213 R A -3.1435
214 S A -2.4299
215 E A -2.5738
216 D A 0.0000
217 T A -0.8887
218 A A 0.0000
219 V A 0.1522
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 A A 0.0000
224 R A 0.0000
225 D A -1.1526
226 G A -1.0224
227 N A -1.1326
228 Y A -0.1533
229 G A -0.5842
230 S A 0.0000
231 D A -0.7339
232 Y A -0.4667
233 W A -0.4950
234 G A 0.0000
235 Q A -1.3262
236 G A -0.6088
237 T A 0.0000
238 T A -0.0673
239 V A 0.0000
240 T A -0.4221
241 V A 0.0000
242 S A -0.9259
243 S A -1.2130
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6071 2.0173 View CSV PDB
4.5 -0.6402 1.9353 View CSV PDB
5.0 -0.6788 1.8326 View CSV PDB
5.5 -0.7151 1.7326 View CSV PDB
6.0 -0.7409 1.7133 View CSV PDB
6.5 -0.751 1.694 View CSV PDB
7.0 -0.7454 1.6749 View CSV PDB
7.5 -0.7294 1.6565 View CSV PDB
8.0 -0.707 1.6397 View CSV PDB
8.5 -0.6798 1.6257 View CSV PDB
9.0 -0.6479 1.612 View CSV PDB