Project name: d385e4715998398

Status: done

Started: 2026-06-26 08:46:59
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MRMRHLGESFYKPG
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d385e4715998398/tmp/folded.pdb                (00:03:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:59)
Show buried residues

Minimal score value
-3.9057
Maximal score value
1.0706
Average score
-0.7454
Total score value
-172.9384

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -1.4767
218 S A 0.0000
219 V A 0.0000
220 A A -0.3398
221 S A -0.6717
222 S A -0.8876
223 K A -1.8482
224 L A 0.0000
225 W A -0.0088
226 M A 0.0000
227 L A -0.0864
228 E A -0.2653
229 F A 0.0122
230 S A 0.0000
231 A A 0.0405
232 F A 0.0000
233 L A 0.0000
234 E A -1.1325
235 Q A 0.0000
236 Q A -1.8535
237 Q A -2.2417
238 D A -1.9909
239 P A -1.6125
240 D A -2.1493
241 T A -1.2337
242 Y A -0.6501
243 N A -1.6782
244 K A -1.9681
245 H A -1.2866
246 L A -0.4296
247 F A 0.0000
248 V A 0.0000
249 H A -0.3311
250 I A 0.0000
251 G A -0.8107
252 Q A -0.9560
253 S A -0.7891
254 S A -0.7687
255 P A -0.5795
256 S A -0.2066
257 Y A 0.4565
258 S A -0.0021
259 D A -0.2078
260 P A -0.1043
261 Y A 0.7384
262 L A -0.1183
263 E A -0.3692
264 A A -0.6833
265 V A 0.0000
266 D A -2.2516
267 I A 0.0000
268 R A -3.0028
269 Q A -2.3475
270 I A 0.0000
271 Y A -1.8795
272 D A -2.1573
273 K A -1.0151
274 F A 0.0000
275 P A 0.0000
276 E A -3.9057
277 K A -3.6173
278 K A -3.1957
279 G A -1.9740
280 G A 0.0000
281 L A 0.0000
282 K A -2.8485
283 D A -2.9175
284 L A -2.2809
285 F A 0.0000
286 E A -3.1994
287 R A -3.0115
288 G A -1.9581
289 P A -1.2954
290 S A -1.2769
291 N A -0.8495
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A 0.0000
300 A A 0.0000
301 D A -0.8502
302 L A 0.0000
303 N A -1.4936
304 T A -1.4408
305 N A -1.4330
306 I A 0.4195
307 E A -1.3354
308 D A -2.2931
309 E A -1.7321
310 G A -1.4738
311 S A -1.3123
312 S A -0.9363
313 F A -0.1693
314 Y A 0.0000
315 G A 0.0000
316 V A -0.2400
317 S A 0.0000
318 S A 0.0000
319 Q A -0.6242
320 Y A 0.0000
321 E A -1.0152
322 S A 0.0000
323 P A -1.6109
324 E A -2.6040
325 N A -1.9804
326 M A 0.0000
327 I A -0.2301
328 I A 0.0000
329 T A -0.1989
330 C A 0.0000
331 S A 0.2209
332 T A -0.0264
333 K A -0.4043
334 V A 0.0000
335 C A 0.0000
336 S A 0.4123
337 F A 0.8244
338 G A 0.0000
339 K A -1.6539
340 Q A -0.9265
341 V A 0.7978
342 V A 0.0051
343 E A -0.3525
344 K A -0.1041
345 V A 1.0706
346 E A 0.3103
347 T A 0.3014
348 E A 0.1489
349 Y A 0.8020
350 A A -0.5861
351 R A -1.2843
352 Y A -0.3628
353 E A -0.9317
354 N A -1.3954
355 G A -0.9796
356 H A -1.3134
357 Y A -1.0378
358 S A 0.0000
359 Y A 0.0000
360 R A -1.4272
361 I A 0.0000
362 H A -1.7973
363 R A -1.6672
364 S A -1.0173
365 P A -0.6832
366 L A 0.0000
367 C A -0.8375
368 E A -1.6962
369 Y A -0.3916
370 M A 0.0000
371 I A -0.9106
372 N A -1.9295
373 F A -1.2149
374 I A 0.0000
375 H A -1.7735
376 K A -2.5242
377 L A 0.0000
378 K A -2.1117
379 H A -1.9355
380 L A -0.9927
381 P A -0.7103
382 E A -0.8216
383 K A -0.4956
384 Y A 0.8386
385 M A 0.4619
386 M A 0.0000
387 N A -0.0364
388 S A 0.0730
389 V A 0.4500
390 L A 0.0000
391 E A -0.3320
392 N A -0.0147
393 F A 0.0000
394 T A 0.0000
395 I A 0.1313
396 L A 0.0000
397 Q A 0.0000
398 V A 0.0000
399 V A 0.0000
400 T A 0.0000
401 N A -1.9488
402 R A -2.1802
403 D A -2.6447
404 T A -2.0452
405 Q A -2.5238
406 E A -2.4197
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A -0.0605
415 F A 0.0000
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.7959
420 S A -1.3179
421 E A -2.3615
422 H A -1.9963
423 G A -1.4260
424 A A -0.8963
425 Q A -0.7453
426 H A -0.7140
427 H A -0.6972
428 I A 0.0000
429 Y A 0.0000
430 R A -0.4907
431 L A 0.0000
432 V A -1.5060
433 K A -3.0241
434 E A -2.9468
1 M B -0.5627
2 R B -2.0257
3 M B 0.0000
4 R B -1.2730
5 H B -1.4912
6 L B -1.0280
7 G B 0.0000
8 E B -1.6859
9 S B -1.1011
10 F B -0.2992
11 Y B -0.8345
12 K B -1.8966
13 P B -1.1438
14 G B -0.9962
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7361 2.7829 View CSV PDB
4.5 -0.7932 2.7165 View CSV PDB
5.0 -0.8628 2.6353 View CSV PDB
5.5 -0.9284 2.5613 View CSV PDB
6.0 -0.9743 2.5202 View CSV PDB
6.5 -0.9915 2.5314 View CSV PDB
7.0 -0.9824 2.5897 View CSV PDB
7.5 -0.9573 2.6748 View CSV PDB
8.0 -0.9242 2.7722 View CSV PDB
8.5 -0.886 2.8779 View CSV PDB
9.0 -0.8428 2.9954 View CSV PDB