Project name: d3ff943246e370e

Status: done

Started: 2026-06-10 10:42:03
Chain sequence(s) A: MKKITAAAGLLLLAAQPAMASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLDHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLDHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLLDHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQDALKQVSAQNKPAHHHHHHCK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d3ff943246e370e/tmp/folded.pdb                (00:04:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:08)
Show buried residues

Minimal score value
-4.1502
Maximal score value
3.5064
Average score
-1.4155
Total score value
-392.0886

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.0424
2 K A -1.4429
3 K A -1.2818
4 I A 0.8251
5 T A 0.2292
6 A A 0.3777
7 A A 0.4438
8 A A 0.5361
9 G A 1.0468
10 L A 2.8076
11 L A 3.4189
12 L A 3.5064
13 L A 2.8670
14 A A 1.1710
15 A A 0.1438
16 Q A -0.8402
17 P A -0.4755
18 A A 0.0938
19 M A 0.5721
20 A A -0.4428
21 S A -1.0902
22 A A -1.8450
23 K A -3.2104
24 D A -2.9057
25 Q A -2.8377
26 L A 0.0000
27 K A -3.6259
28 Q A -3.4248
29 R A -3.5324
30 V A 0.0000
31 Q A -3.3828
32 K A -3.9391
33 L A 0.0000
34 Q A -2.9013
35 E A -4.0650
36 K A -3.8996
37 V A 0.0000
38 S A -2.3195
39 Q A -3.0982
40 Q A -2.9230
41 I A 0.0000
42 A A -1.4223
43 Q A -1.9624
44 D A 0.0000
45 P A -1.1451
46 N A -1.5280
47 L A 0.0000
48 S A -0.5373
49 A A -0.2723
50 Q A -0.5699
51 Q A -0.2459
52 R A -0.2004
53 F A 1.3851
54 L A 1.5043
55 L A 0.6096
56 D A -0.1589
57 H A -0.3579
58 A A -0.5478
59 V A 0.0000
60 Y A -0.7917
61 E A -2.6881
62 D A -2.9409
63 I A 0.0000
64 S A -2.2189
65 H A -2.8281
66 V A 0.0000
67 Q A -2.6625
68 D A -2.7004
69 T A -1.2979
70 I A 0.0000
71 S A -1.6050
72 T A -0.6754
73 L A -0.5768
74 D A -1.9223
75 P A -1.7357
76 S A -1.1154
77 A A -1.1258
78 A A 0.0000
79 N A -1.9599
80 Q A -2.1640
81 V A -1.3398
82 V A 0.0000
83 D A -3.1473
84 Q A -2.8589
85 A A -2.2910
86 A A -2.3755
87 Q A -2.6718
88 Q A -2.7756
89 L A 0.0000
90 Q A -2.4312
91 D A -2.5014
92 A A -1.7610
93 L A 0.0000
94 K A -2.9349
95 Q A -2.5868
96 V A -1.5312
97 S A -1.9390
98 A A -2.0463
99 Q A -2.3353
100 N A -2.1892
101 K A -2.5384
102 P A -1.7050
103 A A -1.7580
104 S A -1.8495
105 A A -2.2154
106 K A -3.4567
107 D A -3.3075
108 Q A -3.2525
109 L A 0.0000
110 K A -3.6597
111 Q A -3.4206
112 R A -3.4650
113 V A 0.0000
114 Q A -3.3382
115 K A -3.8677
116 L A 0.0000
117 Q A 0.0000
118 E A -3.9642
119 K A -3.7784
120 V A 0.0000
121 S A -2.1803
122 Q A -2.9779
123 Q A -2.6739
124 I A 0.0000
125 A A -1.3310
126 Q A -1.8852
127 D A 0.0000
128 P A -1.1139
129 N A -1.5129
130 L A 0.0000
131 S A -0.4874
132 A A -0.1889
133 Q A -0.4508
134 Q A -0.1562
135 R A -0.0539
136 F A 1.5986
137 L A 1.6753
138 L A 0.6884
139 D A -0.0772
140 H A -0.3645
141 A A -0.4514
142 V A 0.0000
143 Y A -0.4162
144 E A -2.4506
145 D A -2.6146
146 I A 0.0000
147 S A -1.8930
148 H A -2.5422
149 V A -1.5517
150 Q A -2.2477
151 D A -2.4755
152 T A -1.1394
153 I A 0.0000
154 S A -1.5135
155 T A -0.6361
156 L A -0.5837
157 D A -1.9501
158 P A -1.8049
159 S A -1.1359
160 A A -1.1224
161 A A 0.0000
162 N A -1.9679
163 Q A -2.1133
164 V A -1.1311
165 V A 0.0000
166 D A -2.9798
167 Q A -2.8309
168 A A -2.2147
169 A A -2.3153
170 Q A -2.8129
171 Q A -2.8055
172 L A 0.0000
173 Q A -2.2964
174 D A -2.5452
175 A A -1.7881
176 L A 0.0000
177 K A -2.8882
178 Q A -2.5831
179 V A -1.5441
180 S A -1.9416
181 A A -2.0408
182 Q A -2.3386
183 N A -2.1945
184 K A -2.5365
185 P A -1.6252
186 A A -1.5427
187 S A -1.6055
188 A A -1.9448
189 K A -3.1554
190 D A -2.8233
191 Q A -2.7695
192 L A 0.0000
193 K A -3.7499
194 Q A -3.2924
195 R A -3.1599
196 V A 0.0000
197 Q A -3.5438
198 K A -3.9662
199 L A 0.0000
200 Q A -3.0225
201 E A -4.1502
202 K A -3.9845
203 V A 0.0000
204 S A -2.4338
205 Q A -3.1706
206 Q A -2.9901
207 I A 0.0000
208 A A -1.4886
209 Q A -1.9732
210 D A 0.0000
211 P A -1.0942
212 N A -1.4658
213 L A 0.0000
214 S A -0.5289
215 A A -0.2361
216 Q A -0.5453
217 Q A -0.2935
218 R A -0.3034
219 F A 1.2889
220 L A 1.4147
221 L A 0.4786
222 D A -0.4796
223 H A -0.5021
224 A A -0.5151
225 V A 0.0000
226 Y A -0.4754
227 E A -2.3151
228 D A -2.7153
229 I A 0.0000
230 S A -1.9392
231 H A -2.6302
232 V A 0.0000
233 Q A -2.5570
234 D A -2.6257
235 T A -1.2776
236 I A 0.0000
237 S A -1.6381
238 T A -0.7017
239 L A -0.6691
240 D A -1.9180
241 P A -1.6130
242 S A -1.0623
243 A A -1.0745
244 A A 0.0000
245 N A -1.9180
246 Q A -1.9974
247 V A -1.2110
248 V A 0.0000
249 D A -2.6947
250 Q A -2.7390
251 A A -2.1875
252 A A -2.2511
253 Q A -2.6649
254 Q A -2.7694
255 L A 0.0000
256 Q A -2.5489
257 D A -2.5358
258 A A -1.7798
259 L A 0.0000
260 K A -2.9447
261 Q A -2.5958
262 V A -1.5807
263 S A -1.9332
264 A A -2.0424
265 Q A -2.3339
266 N A -2.1816
267 K A -2.6054
268 P A -1.7902
269 A A -1.6718
270 H A -2.2445
271 H A -2.4956
272 H A -2.7620
273 H A -2.6775
274 H A -2.4903
275 H A -2.1305
276 C A -1.0893
277 K A -1.7934
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.2022 4.5903 View CSV PDB
4.5 -1.2794 4.5903 View CSV PDB
5.0 -1.3613 4.5903 View CSV PDB
5.5 -1.4235 4.5903 View CSV PDB
6.0 -1.4476 4.5903 View CSV PDB
6.5 -1.4354 4.5903 View CSV PDB
7.0 -1.402 4.5903 View CSV PDB
7.5 -1.3589 4.5903 View CSV PDB
8.0 -1.3085 4.5903 View CSV PDB
8.5 -1.2471 4.5903 View CSV PDB
9.0 -1.1695 4.5903 View CSV PDB