Project name: 5B5 ANTIBODY 1

Status: done

Started: 2026-03-17 05:29:05
Chain sequence(s) A: DIVMTQTPLSLSVTPGQPASISCRSSQSLVHSNGNTYLEWYLQKPGQPPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSQVPFTFGSGTKLEIKGGGGSGGGGSGGGGSVQLVQSGAEVKKPGASVKVSCKASGYTFTDYIMLWVRQAPGQGLEWMGNIDPYYGSTGYALKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDGNYGSDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:03)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:20)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:21)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:21)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d4cea8321ff70e5/tmp/folded.pdb                (00:05:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:31)
Show buried residues

Minimal score value
-3.131
Maximal score value
1.6994
Average score
-0.6471
Total score value
-157.2507

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.1048
2 I A 0.0000
3 V A 0.7608
4 M A 0.0000
5 T A -0.2778
6 Q A 0.0000
7 T A 0.0115
8 P A 0.4761
9 L A 1.2517
10 S A 0.1298
11 L A -0.2677
12 S A -1.1478
13 V A 0.0000
14 T A -1.5664
15 P A -1.7133
16 G A -1.6016
17 Q A -1.7754
18 P A -1.9302
19 A A 0.0000
20 S A -0.8934
21 I A 0.0000
22 S A -0.9241
23 C A 0.0000
24 R A -2.2930
25 S A 0.0000
26 S A -1.0023
27 Q A -1.6066
28 S A -0.9559
29 L A 0.0000
30 V A 0.4257
31 H A -0.5855
32 S A -0.8681
33 N A -1.5815
34 G A -0.9995
35 N A -0.8013
36 T A -0.2096
37 Y A -0.0393
38 L A 0.0000
39 E A -0.3695
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A -0.7696
44 K A -1.4982
45 P A -1.0910
46 G A -1.3780
47 Q A -1.7808
48 P A -1.0910
49 P A 0.0000
50 Q A -0.8070
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A -0.5754
55 K A -1.0656
56 V A 0.0000
57 S A -1.1307
58 N A -1.3243
59 R A -1.7459
60 F A -0.4866
61 S A -0.5259
62 G A -1.0301
63 V A -0.9348
64 P A -1.2918
65 D A -2.4313
66 R A -2.1897
67 F A 0.0000
68 S A -1.6297
69 G A 0.0000
70 S A -1.1002
71 G A -1.0878
72 S A -0.7501
73 G A -0.6699
74 T A -1.4539
75 D A -2.1072
76 F A 0.0000
77 T A -1.2037
78 L A 0.0000
79 K A -2.2247
80 I A 0.0000
81 S A -2.3036
82 R A -3.0948
83 V A 0.0000
84 E A -2.2317
85 A A -1.7533
86 E A -2.4136
87 D A 0.0000
88 V A -1.0631
89 G A 0.0000
90 V A -0.0651
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 F A 0.0000
95 Q A 0.0000
96 G A 0.0793
97 S A 0.0000
98 Q A -0.3984
99 V A 1.1986
100 P A 0.5344
101 F A 0.6140
102 T A 0.3423
103 F A 0.3453
104 G A 0.0000
105 S A -0.0086
106 G A 0.0000
107 T A 0.0000
108 K A -0.4807
109 L A 0.0000
110 E A -1.7783
111 I A -1.9203
112 K A -2.3842
113 G A -1.8255
114 G A -1.7205
115 G A -1.3426
116 G A -1.4812
117 S A -1.2711
118 G A -1.6000
119 G A -1.6487
120 G A -1.7316
121 G A -1.6699
122 S A -1.0828
123 G A -1.3605
124 G A -1.2569
125 G A -1.3122
126 G A -1.1563
127 S A -0.9545
128 V A -0.7600
129 Q A -1.4489
130 L A 0.0000
131 V A -0.1066
132 Q A 0.0000
133 S A -0.7565
134 G A -0.7431
135 A A -0.2517
136 E A -0.5477
137 V A 0.7025
138 K A -1.0050
139 K A -2.1559
140 P A -2.2640
141 G A -1.6014
142 A A -1.2437
143 S A -1.3770
144 V A 0.0000
145 K A -2.1228
146 V A 0.0000
147 S A -0.7593
148 C A 0.0000
149 K A -1.3196
150 A A 0.0000
151 S A -0.8160
152 G A -0.7911
153 Y A -0.4942
154 T A -0.5772
155 F A 0.0000
156 T A -0.1266
157 D A -1.4212
158 Y A -0.6928
159 I A 0.0256
160 M A 0.0000
161 L A 0.0000
162 W A 0.0000
163 V A 0.0000
164 R A -0.4093
165 Q A -0.6645
166 A A -1.0521
167 P A -1.0419
168 G A -1.2147
169 Q A -1.7056
170 G A -0.9930
171 L A 0.0000
172 E A -0.5849
173 W A 0.0000
174 M A 0.0000
175 G A 0.0000
176 N A -0.3360
177 I A 0.0000
178 D A 0.1136
179 P A 0.0000
180 Y A 1.3941
181 Y A 1.6994
182 G A 0.4313
183 S A 0.1353
184 T A -0.1394
185 G A -0.0164
186 Y A -0.0640
187 A A 0.0000
188 L A 0.0599
189 K A -1.5386
190 F A 0.0000
191 K A -1.9618
192 G A -1.5151
193 R A -1.4288
194 V A 0.0000
195 T A -0.9066
196 M A 0.0000
197 T A -0.6150
198 R A -0.8744
199 D A -1.1667
200 T A -0.4863
201 S A -0.5479
202 T A -0.7252
203 S A -0.8303
204 T A 0.0000
205 V A 0.0000
206 Y A -0.8340
207 M A 0.0000
208 E A -1.5109
209 L A 0.0000
210 S A -1.1714
211 S A -1.2629
212 L A 0.0000
213 R A -3.1310
214 S A -2.4074
215 E A -2.5901
216 D A 0.0000
217 T A -0.8651
218 A A 0.0000
219 V A 0.1814
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 A A 0.0000
224 R A 0.0000
225 D A -1.2238
226 G A -0.9758
227 N A -1.0758
228 Y A -0.3048
229 G A 0.0000
230 S A 0.0000
231 D A 0.0000
232 Y A -0.4652
233 W A -0.4275
234 G A 0.0000
235 Q A -1.3011
236 G A -0.6222
237 T A 0.0000
238 T A -0.0894
239 V A 0.0000
240 T A -0.4139
241 V A 0.0000
242 S A -1.0845
243 S A -1.0062
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6295 1.9852 View CSV PDB
4.5 -0.6633 1.8942 View CSV PDB
5.0 -0.7023 1.7837 View CSV PDB
5.5 -0.7384 1.6646 View CSV PDB
6.0 -0.763 1.6266 View CSV PDB
6.5 -0.7705 1.607 View CSV PDB
7.0 -0.7617 1.5876 View CSV PDB
7.5 -0.7423 1.5686 View CSV PDB
8.0 -0.7172 1.6164 View CSV PDB
8.5 -0.6876 1.6752 View CSV PDB
9.0 -0.6536 1.7316 View CSV PDB