Project name: d5f2b1db8cf0e8d

Status: done

Started: 2025-06-28 13:38:55
Chain sequence(s) A: MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d5f2b1db8cf0e8d/tmp/folded.pdb                (00:06:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:13)
Show buried residues

Minimal score value
-4.0181
Maximal score value
1.2569
Average score
-1.0786
Total score value
-306.3287

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.0074
2 T A 0.2694
3 T A 0.0247
4 A A -0.0510
5 H A -0.2840
6 F A 0.8305
7 Y A 1.0527
8 C A 0.0000
9 Q A -0.0882
10 Y A 1.2569
11 C A 0.8327
12 T A 0.3903
13 A A 0.6144
14 S A 0.2657
15 L A 0.0000
16 L A 0.8591
17 G A -0.6704
18 K A -1.7209
19 K A -1.6760
20 Y A 0.5164
21 V A 0.7852
22 L A 0.2788
23 K A -1.4196
24 D A -2.7230
25 D A -2.4775
26 S A -1.2396
27 P A 0.1507
28 Y A 0.7680
29 C A 0.0000
30 V A -0.4819
31 T A -0.2120
32 C A 0.4257
33 Y A 0.5124
34 D A 0.0000
35 R A -1.2696
36 V A 0.8589
37 F A 0.5347
38 S A -0.5037
39 N A -1.0557
40 Y A -0.9179
41 C A 0.0000
42 E A -2.1088
43 E A -2.7167
44 C A -1.8881
45 K A -2.7305
46 K A -2.8243
47 P A -1.5311
48 I A 0.0000
49 E A -2.6698
50 S A -2.1164
51 D A -2.7166
52 S A -2.6600
53 K A -2.9994
54 D A -2.2005
55 L A -1.2437
56 C A -0.6459
57 Y A -0.9845
58 K A -2.4945
59 D A -2.7836
60 R A -2.1574
61 H A -1.6942
62 W A 0.0000
63 H A -2.3660
64 E A -2.5510
65 G A -1.7938
66 C A -1.6250
67 F A 0.0000
68 K A -2.2806
69 C A 0.0000
70 T A -2.3105
71 K A -2.5091
72 C A -1.7793
73 N A -2.3271
74 H A -2.0354
75 S A -1.8908
76 L A 0.0000
77 V A -1.7988
78 E A -2.4456
79 K A -2.3742
80 P A -1.2814
81 F A -0.4474
82 A A -0.7345
83 A A -1.8185
84 K A -2.8709
85 D A -3.7101
86 E A -3.9969
87 R A -4.0181
88 L A 0.0000
89 L A 0.0000
90 C A -1.1938
91 T A -1.0479
92 E A -2.0755
93 C A -1.4430
94 Y A -1.1695
95 S A -1.0688
96 N A -2.0490
97 E A -2.0953
98 C A -0.5650
99 S A -1.0101
100 S A -1.4619
101 K A -2.6401
102 C A 0.0000
103 F A -0.3128
104 H A -1.0691
105 C A -1.5007
106 K A -2.7808
107 R A -3.0654
108 T A -2.0029
109 I A 0.0000
110 M A -1.0958
111 P A -0.9490
112 G A -1.1079
113 S A -1.6226
114 R A -2.8464
115 K A -2.8672
116 M A -1.9602
117 E A -2.3061
118 F A -1.4297
119 K A -2.1967
120 G A -1.5393
121 N A -1.2617
122 Y A -1.4249
123 W A 0.0000
124 H A -1.9999
125 E A -1.9904
126 T A -1.3538
127 C A -0.7616
128 F A 0.0000
129 V A -1.4042
130 C A 0.0000
131 E A -1.8413
132 N A -2.0964
133 C A -1.5218
134 R A -2.6909
135 Q A -2.2487
136 P A -1.5779
137 I A 0.0000
138 G A -1.2517
139 T A -0.9548
140 K A -1.4244
141 P A -0.5943
142 L A 0.0865
143 I A 0.3508
144 S A -0.7427
145 K A -1.8792
146 E A -2.4431
147 S A -1.6085
148 G A -1.4680
149 N A -0.9117
150 Y A 0.0000
151 C A -0.5191
152 V A -0.2540
153 P A -0.8537
154 C A 0.0000
155 F A -0.9931
156 E A -1.6373
157 K A -2.6857
158 E A -2.4975
159 F A -0.5804
160 A A -1.1320
161 H A -1.5320
162 Y A -1.0095
163 C A 0.0000
164 N A -0.7427
165 F A 0.7933
166 C A -0.3190
167 K A -1.9207
168 K A -2.0468
169 V A -1.1586
170 I A -0.8649
171 T A -0.5164
172 S A -0.6429
173 G A -0.8493
174 G A -0.8761
175 I A -0.5962
176 T A -0.6071
177 F A -0.5650
178 C A -1.0850
179 D A -2.0998
180 Q A -1.5156
181 L A -0.6227
182 W A 0.0000
183 H A -1.3528
184 K A -2.5965
185 E A -2.6119
186 C A -1.2733
187 F A 0.0000
188 L A -1.3691
189 C A 0.0000
190 S A -0.6234
191 G A -0.6594
192 C A -1.1559
193 R A -2.4249
194 K A -2.7744
195 D A -3.3245
196 L A 0.0000
197 C A -2.2685
198 E A -2.9629
199 E A -2.9651
200 Q A -1.9905
201 F A -0.6700
202 M A -0.1988
203 S A -0.9151
204 R A -2.2122
205 D A -2.8250
206 D A -2.6236
207 Y A -0.5086
208 P A 0.0000
209 F A 0.0000
210 C A 0.0000
211 V A -0.6542
212 D A -1.5097
213 C A -0.5795
214 Y A 0.0758
215 N A -0.7238
216 H A -1.0692
217 L A 0.8721
218 Y A 0.3426
219 A A -0.8812
220 N A -1.6914
221 K A -1.6066
222 C A 0.0000
223 V A 0.2113
224 A A -0.1233
225 C A -0.2328
226 S A -0.9787
227 K A -2.1949
228 P A -1.7140
229 I A 0.0000
230 S A -0.8930
231 G A -0.4621
232 L A 0.5477
233 T A -0.2128
234 G A -0.6342
235 A A -0.7210
236 K A -1.4294
237 F A 0.3322
238 I A 0.8789
239 C A 0.4884
240 F A -0.0832
241 Q A -1.6378
242 D A -2.1234
243 S A 0.0000
244 Q A -0.1281
245 W A 0.0000
246 H A -0.6687
247 S A -0.6919
248 E A -1.7013
249 C A -0.3994
250 F A 0.0000
251 N A -0.6548
252 C A 0.0000
253 G A -1.3351
254 K A -1.9036
255 C A -0.5581
256 S A -0.3359
257 V A 0.3133
258 S A -0.2865
259 L A 0.0000
260 V A 0.1827
261 G A -0.8021
262 K A -1.8796
263 G A -1.1767
264 F A -0.5074
265 L A -0.4786
266 T A -1.2325
267 Q A -2.1848
268 N A -2.7780
269 K A -2.8241
270 E A -2.4699
271 I A 0.0000
272 F A -0.9721
273 C A 0.0000
274 Q A -1.8821
275 K A -2.3554
276 C A -1.6045
277 G A -1.4205
278 S A -1.1116
279 G A -1.1018
280 M A -1.0019
281 D A -2.0270
282 T A -1.2297
283 D A -1.2063
284 I A 0.9032
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0071 3.097 View CSV PDB
4.5 -1.0959 2.9443 View CSV PDB
5.0 -1.2057 2.7317 View CSV PDB
5.5 -1.3092 2.4859 View CSV PDB
6.0 -1.3764 2.5078 View CSV PDB
6.5 -1.3896 2.62 View CSV PDB
7.0 -1.3536 2.7918 View CSV PDB
7.5 -1.2876 2.9963 View CSV PDB
8.0 -1.2069 3.2139 View CSV PDB
8.5 -1.1166 3.4355 View CSV PDB
9.0 -1.016 3.6564 View CSV PDB