Project name: d632b53b1dbd7bd

Status: done

Started: 2026-03-16 14:33:10
Chain sequence(s) A: MLTVSVPSSRDLFDDPCATFRLPPRSVNATYLNEASVEQPWIEPPFGFGYGKWALSWTSIEEYWSWSNMQNEWYPLSSTVNGSRLSDIHATVIADVNSFQLGDNDTVIETPGTDTPLPGQIYAWNYTIPAEIMAETDHTAWAGWGYDFYEQGAPYFVSYDAATTGVKNVSHGVSIYSRLERGPSDRTVAEVAECYDRLGSEAFSSLFRSMKRTPTDGRRSHNLSWRGVAVENAQVEGRRSYQKPI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d632b53b1dbd7bd/tmp/folded.pdb                (00:04:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:37)
Show buried residues

Minimal score value
-3.1178
Maximal score value
2.6339
Average score
-0.5498
Total score value
-134.6988

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.9991
2 L A 2.4874
3 T A 1.9835
4 V A 2.6339
5 S A 1.5851
6 V A 1.7482
7 P A 0.0256
8 S A -0.7752
9 S A -0.8463
10 R A -2.4697
11 D A -2.3284
12 L A -0.2740
13 F A -0.7741
14 D A -2.1842
15 D A -1.4472
16 P A -1.2746
17 C A 0.0000
18 A A -0.5974
19 T A 0.0000
20 F A 0.0000
21 R A -0.4917
22 L A 0.0000
23 P A 0.0000
24 P A -0.7313
25 R A -2.0717
26 S A -1.2345
27 V A -0.8742
28 N A -1.0635
29 A A -1.2838
30 T A -0.9970
31 Y A 0.0000
32 L A -1.2673
33 N A -1.9865
34 E A -2.0859
35 A A -1.7391
36 S A -1.1011
37 V A -1.0235
38 E A -2.0611
39 Q A -1.8091
40 P A -1.0571
41 W A -0.5840
42 I A -0.0861
43 E A -0.5441
44 P A 0.0000
45 P A 0.5045
46 F A 1.7345
47 G A 1.0847
48 F A 0.5293
49 G A 0.4210
50 Y A 0.5374
51 G A -0.2150
52 K A -0.6631
53 W A 0.0000
54 A A 0.0000
55 L A 0.0000
56 S A 0.0000
57 W A -0.7300
58 T A 0.0000
59 S A -1.3440
60 I A 0.0000
61 E A -2.2246
62 E A -1.4312
63 Y A -0.7508
64 W A -0.7177
65 S A -0.1232
66 W A 0.2302
67 S A -0.3853
68 N A 0.0000
69 M A 0.0000
70 Q A 0.0000
71 N A 0.0000
72 E A -0.5445
73 W A 0.0000
74 Y A 0.8135
75 P A 0.5106
76 L A 0.5521
77 S A -0.2574
78 S A -0.4650
79 T A -0.5658
80 V A 0.0386
81 N A -1.1749
82 G A -1.1636
83 S A -1.1391
84 R A -1.8295
85 L A -0.2273
86 S A -0.7132
87 D A -1.1994
88 I A 0.9270
89 H A -0.3980
90 A A -0.1316
91 T A -0.0925
92 V A 0.4484
93 I A 0.0000
94 A A 0.0000
95 D A 0.0000
96 V A -0.4407
97 N A -0.6878
98 S A -0.4224
99 F A 0.0000
100 Q A 0.0000
101 L A 0.5073
102 G A -1.2818
103 D A -2.8802
104 N A -2.7004
105 D A -2.4199
106 T A -0.8434
107 V A 0.4898
108 I A 0.2792
109 E A -1.2570
110 T A 0.0000
111 P A -0.3809
112 G A 0.0000
113 T A 0.2042
114 D A 0.0000
115 T A -0.0582
116 P A 0.0330
117 L A 0.0000
118 P A -0.4486
119 G A -0.4527
120 Q A -0.0478
121 I A 1.2853
122 Y A 0.8080
123 A A 0.0000
124 W A 0.0000
125 N A -0.4239
126 Y A -0.1800
127 T A -0.1414
128 I A 0.0000
129 P A -0.2384
130 A A -0.2102
131 E A -1.1479
132 I A 0.6768
133 M A 0.6310
134 A A 0.2812
135 E A 0.0000
136 T A -0.2162
137 D A -0.6757
138 H A -0.6443
139 T A 0.0000
140 A A 0.0000
141 W A 0.0000
142 A A 0.0000
143 G A 0.0000
144 W A 0.0000
145 G A 0.1995
146 Y A 0.1502
147 D A 0.0000
148 F A 0.2093
149 Y A -0.0906
150 E A -0.1339
151 Q A -0.8290
152 G A -0.2162
153 A A 0.0000
154 P A 0.0452
155 Y A 0.0000
156 F A 0.0000
157 V A 0.0000
158 S A 0.0000
159 Y A 0.0000
160 D A -0.5992
161 A A -0.5428
162 A A -0.8497
163 T A -0.8008
164 T A -0.5191
165 G A -0.0148
166 V A 1.0253
167 K A -0.9006
168 N A -1.4908
169 V A 0.0000
170 S A -1.3416
171 H A -1.0643
172 G A 0.0000
173 V A 0.0000
174 S A 0.0000
175 I A 0.0000
176 Y A 0.0000
177 S A 0.0000
178 R A -0.6890
179 L A -0.8381
180 E A 0.0000
181 R A -1.3722
182 G A 0.0000
183 P A 0.0000
184 S A -1.5419
185 D A -2.8065
186 R A -2.7475
187 T A 0.0000
188 V A -1.8260
189 A A -2.2199
190 E A -2.3497
191 V A 0.0000
192 A A 0.0000
193 E A -2.9631
194 C A 0.0000
195 Y A 0.0000
196 D A -3.0656
197 R A -2.7376
198 L A 0.0000
199 G A -2.0435
200 S A 0.0000
201 E A -2.5289
202 A A -1.3898
203 F A 0.0000
204 S A 0.0000
205 S A -1.3692
206 L A -0.7965
207 F A 0.0000
208 R A -2.0667
209 S A -1.4958
210 M A 0.0000
211 K A -2.2097
212 R A -1.7168
213 T A 0.0000
214 P A -0.9060
215 T A -1.4768
216 D A -2.5082
217 G A -1.8620
218 R A -1.9523
219 R A -1.5273
220 S A -1.8621
221 H A -1.9245
222 N A -1.6399
223 L A 0.0000
224 S A -1.0248
225 W A -1.0395
226 R A -1.7763
227 G A -0.2363
228 V A 1.3633
229 A A 0.6017
230 V A 1.0147
231 E A -1.4834
232 N A -1.6904
233 A A -1.2260
234 Q A -1.6651
235 V A -0.3052
236 E A -2.3853
237 G A -2.4566
238 R A -3.1178
239 R A -3.0362
240 S A -1.6493
241 Y A -0.6394
242 Q A -1.4931
243 K A -1.5756
244 P A -0.2428
245 I A 1.3214
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3601 4.8531 View CSV PDB
4.5 -0.4332 4.8234 View CSV PDB
5.0 -0.5205 4.7815 View CSV PDB
5.5 -0.6099 4.738 View CSV PDB
6.0 -0.6909 4.7055 View CSV PDB
6.5 -0.7565 4.6932 View CSV PDB
7.0 -0.8044 4.6976 View CSV PDB
7.5 -0.8385 4.7055 View CSV PDB
8.0 -0.8629 4.7102 View CSV PDB
8.5 -0.8778 4.712 View CSV PDB
9.0 -0.882 4.7126 View CSV PDB