Project name: new 11

Status: done

Started: 2026-03-17 06:32:19
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVKLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:13)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:14)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d6789f4bdb5ba8b/tmp/folded.pdb                (00:03:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:36)
Show buried residues

Minimal score value
-2.9485
Maximal score value
1.4693
Average score
-0.738
Total score value
-182.2982

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.6238
2 I A 0.0000
3 V A 0.7063
4 L A 0.0000
5 T A -0.6466
6 Q A -0.6842
7 S A -0.7382
8 P A -0.3073
9 A A -0.3005
10 T A -0.3855
11 L A -0.1836
12 S A -0.6341
13 L A -1.0905
14 S A -1.7582
15 P A -2.0472
16 G A -1.7750
17 E A -2.3843
18 R A -2.5837
19 A A 0.0000
20 T A -0.6678
21 L A 0.0000
22 S A -0.9906
23 C A 0.0000
24 R A -2.5246
25 V A 0.0000
26 S A -1.2593
27 Q A -2.5515
28 N A -2.6672
29 V A 0.0000
30 S A -1.4673
31 S A -1.0732
32 N A -1.4124
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -0.7615
39 K A -1.1871
40 P A -0.7498
41 G A -1.1732
42 Q A -1.6375
43 A A -1.2292
44 P A 0.0000
45 R A -1.5139
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -0.8521
51 T A 0.0000
52 S A -1.1259
53 N A -1.5523
54 R A -1.6485
55 A A 0.0000
56 T A -0.7024
57 G A -0.8361
58 I A 0.0000
59 P A -0.4804
60 A A -0.4027
61 R A -0.7506
62 F A 0.0000
63 S A -0.6697
64 G A 0.0000
65 S A -0.8096
66 G A -1.1152
67 S A -1.3310
68 G A -1.6787
69 T A -2.1398
70 D A -2.4584
71 F A 0.0000
72 T A -0.8283
73 L A 0.0000
74 T A -0.5987
75 I A 0.0000
76 S A -1.3867
77 S A -1.7520
78 L A 0.0000
79 E A -2.0498
80 P A -2.1995
81 E A -2.4753
82 D A 0.0000
83 F A -0.7073
84 A A 0.0000
85 V A -0.1551
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.2914
92 R A -2.7849
93 N A -2.2389
94 W A -0.8718
95 P A -0.9922
96 L A 0.0000
97 T A -0.3882
98 F A 0.1618
99 G A 0.0000
100 G A -0.7497
101 G A -0.6933
102 T A 0.0000
103 K A -0.7002
104 V A 0.0000
105 E A -1.0468
106 I A -1.7622
107 K A -2.1292
108 G A -1.6712
109 G A -1.8063
110 G A -1.3282
111 G A -1.2562
112 S A -1.3390
113 G A -1.4534
114 G A -1.6040
115 G A -1.5169
116 G A -1.4950
117 S A -1.0487
118 G A -1.4860
119 G A -1.5328
120 G A -1.5431
121 G A -1.5582
122 S A -1.6960
123 E A -2.7018
124 V A -1.6116
125 K A -2.0882
126 L A 0.0000
127 V A 0.1288
128 E A 0.0000
129 S A -0.3986
130 G A -0.8187
131 G A 0.0363
132 G A 0.5582
133 L A 1.3014
134 V A 0.0000
135 Q A -1.5144
136 P A -1.8461
137 G A -1.5629
138 G A -1.0582
139 S A -1.3588
140 L A -1.0744
141 R A -2.1891
142 L A 0.0000
143 S A -0.5396
144 C A 0.0000
145 A A -0.4098
146 A A 0.0000
147 S A -1.1080
148 G A -1.3523
149 F A -0.9713
150 T A -0.7036
151 F A 0.0000
152 S A -1.5800
153 R A -2.0104
154 Y A -0.9938
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6219
162 A A -1.0369
163 P A -0.8352
164 G A -1.4449
165 K A -2.2640
166 G A -1.3665
167 L A 0.0000
168 E A -0.9465
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 S A 0.0000
173 I A 0.0000
174 S A -0.1615
175 A A -0.8267
176 S A -0.7898
177 G A -0.4577
178 A A -0.1327
179 T A -0.0218
180 T A 0.1876
181 Y A 0.1848
182 Y A -0.5626
183 A A 0.0000
184 D A -2.4402
185 P A -1.8652
186 V A 0.0000
187 K A -2.5865
188 G A -1.7580
189 R A -1.5519
190 F A 0.0000
191 T A -0.8201
192 I A 0.0000
193 S A -0.4379
194 R A -1.0075
195 D A -1.6398
196 N A -1.9182
197 S A -1.6056
198 K A -2.3929
199 N A -1.7657
200 T A -1.1004
201 L A 0.0000
202 Y A -0.5893
203 L A 0.0000
204 Q A -1.4069
205 M A 0.0000
206 N A -1.4549
207 S A -1.3747
208 L A 0.0000
209 R A -2.9485
210 A A -2.0440
211 E A -2.4622
212 D A 0.0000
213 T A -0.5377
214 A A 0.0000
215 V A 0.7223
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -1.7574
224 F A -0.5548
225 D A -0.8625
226 I A 1.0685
227 L A 0.6527
228 T A 0.5842
229 G A 0.5309
230 Y A 1.1704
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -1.0777
236 P A -1.3538
237 W A 0.0000
238 G A 0.0000
239 Q A -1.3855
240 G A 0.0000
241 T A 0.4163
242 L A 1.4693
243 V A 0.0000
244 T A 0.1830
245 V A 0.0000
246 S A -0.8240
247 S A -0.7782
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6374 3.5264 View CSV PDB
4.5 -0.6757 3.3076 View CSV PDB
5.0 -0.7221 3.0432 View CSV PDB
5.5 -0.7691 2.7574 View CSV PDB
6.0 -0.8083 2.4639 View CSV PDB
6.5 -0.8328 2.1686 View CSV PDB
7.0 -0.8411 2.0976 View CSV PDB
7.5 -0.8378 2.0976 View CSV PDB
8.0 -0.8274 2.0976 View CSV PDB
8.5 -0.8114 2.0976 View CSV PDB
9.0 -0.79 2.0976 View CSV PDB