Project name: d6acd8628d12271

Status: done

Started: 2026-03-11 20:06:34
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGGGSGGGGSEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:52)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d6acd8628d12271/tmp/folded.pdb                (00:02:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:51)
Show buried residues

Minimal score value
-3.7442
Maximal score value
4.0548
Average score
-0.6634
Total score value
-158.5633

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1525
2 H A -1.3861
3 H A -2.0911
4 H A -2.5453
5 H A -2.6701
6 H A -2.5637
7 H A -2.2815
8 F A -1.6918
9 D A -2.6656
10 A A -1.9847
11 S A -2.1390
12 N A -2.3948
13 F A 0.0000
14 K A -2.2812
15 D A -1.0378
16 F A -0.3378
17 S A -0.5889
18 S A -1.1384
19 I A 0.0000
20 A A -0.4725
21 S A -0.8979
22 A A -0.8965
23 S A -0.7085
24 S A 0.0000
25 S A -0.1752
26 W A 0.0000
27 Q A -0.9883
28 N A 0.0000
29 Q A -1.8846
30 S A -1.5784
31 G A -1.4541
32 S A 0.0000
33 T A -0.8025
34 M A 0.0000
35 I A -0.0791
36 I A 0.0000
37 Q A -1.6256
38 V A 0.0000
39 D A -0.8514
40 S A 0.2840
41 F A 1.0759
42 G A 0.0000
43 N A -1.3032
44 V A 0.0000
45 S A -1.2706
46 G A -0.8014
47 Q A -0.7561
48 Y A 0.0000
49 V A -1.0738
50 N A 0.0000
51 R A -3.1463
52 A A -2.2217
53 Q A -2.1472
54 G A -1.5175
55 T A -1.3152
56 G A -1.7319
57 C A 0.0000
58 Q A -2.9084
59 N A -2.5168
60 S A -1.6554
61 P A -1.1513
62 Y A 0.0000
63 P A -0.8422
64 L A 0.0000
65 T A -1.0233
66 G A -1.4022
67 R A -2.0078
68 V A 0.0000
69 N A -0.9878
70 G A -0.4797
71 T A 0.1027
72 F A 1.1075
73 I A 0.0000
74 A A -0.4518
75 F A 0.0000
76 S A -0.6565
77 V A 0.0000
78 G A -1.1118
79 W A -1.7870
80 N A -2.7204
81 N A -1.9699
82 S A -1.2981
83 T A -1.7150
84 E A -3.0477
85 N A -2.9764
86 C A -1.9352
87 N A -2.3356
88 S A -1.0147
89 A A -0.4857
90 T A 0.0000
91 G A -0.5907
92 W A 0.0000
93 T A -0.0440
94 G A 0.0000
95 Y A 1.1797
96 A A 0.0000
97 Q A -0.5101
98 V A -1.2212
99 N A -1.7579
100 G A -1.6712
101 N A -2.2277
102 N A -1.7221
103 T A 0.0000
104 E A 0.0000
105 I A 0.0000
106 V A 0.3601
107 T A 0.0000
108 S A -0.8703
109 W A -1.0189
110 N A -1.1765
111 L A 0.0000
112 A A -0.1635
113 Y A -0.5940
114 E A -1.8898
115 G A -1.0998
116 G A -1.0910
117 S A -0.9097
118 G A -1.0670
119 P A -0.7553
120 A A 0.0639
121 I A 0.8136
122 E A -0.8859
123 Q A -1.8636
124 G A -1.7294
125 Q A -1.7680
126 D A -1.1606
127 T A -0.7195
128 F A 0.0000
129 Q A -0.8642
130 Y A 0.0000
131 V A 0.1512
132 P A -0.6134
133 T A -0.8712
134 T A -1.6032
135 E A -3.0135
136 N A -2.8255
137 K A -2.5161
138 S A -0.9650
139 L A 0.7914
140 L A 0.6495
141 K A -1.7275
142 D A -2.2514
143 T A -1.6453
144 G A -1.6729
145 G A -1.3764
146 G A -1.2044
147 G A -1.2071
148 S A -1.0945
149 G A -1.1671
150 G A -1.2250
151 G A -1.3724
152 G A -1.4950
153 S A -1.8281
154 E A -2.4159
155 P A -1.6905
156 R A -2.0356
157 I A -0.5487
158 Q A -1.9679
159 K A -2.3378
160 E A -1.5574
161 Y A 0.6014
162 Y A 1.7267
163 Y A 1.7610
164 N A 0.1667
165 L A 0.2926
166 H A -1.8950
167 E A -2.9982
168 N A -3.0753
169 N A -2.9222
170 S A -2.0990
171 Q A -2.3191
172 A A -1.8086
173 N A -2.7275
174 H A -2.6010
175 N A -2.5833
176 K A -2.3361
177 F A -0.2101
178 H A -1.3547
179 E A -1.8237
180 M A -0.2211
181 P A -1.1813
182 E A -2.0651
183 Y A -0.9247
184 D A -2.8006
185 D A -2.9517
186 Q A -2.4796
187 L A -0.9425
188 P A -1.0307
189 D A -1.1864
190 F A 0.4943
191 P A -1.0533
192 H A -1.8383
193 K A -2.4442
194 Q A -2.3741
195 L A -1.2576
196 E A -3.2932
197 E A -3.7011
198 E A -3.7442
199 Q A -3.0346
200 N A -2.4308
201 P A -0.8605
202 F A 0.9006
203 H A -0.9558
204 K A -0.9814
205 L A 1.2598
206 S A 0.2844
207 E A -0.4928
208 V A 2.0211
209 L A 1.8174
210 N A -0.4280
211 S A -0.0815
212 G A 0.3668
213 S A 1.3211
214 V A 2.9940
215 V A 4.0548
216 P A 2.9957
217 L A 3.6407
218 W A 3.7098
219 L A 3.8076
220 V A 3.6648
221 N A 2.3014
222 P A 2.7534
223 I A 3.5343
224 Y A 3.3832
225 Y A 3.1530
226 V A 2.7890
227 L A 2.8411
228 E A 0.7610
229 L A 1.6686
230 F A 2.7232
231 P A 1.2111
232 R A 0.6172
233 A A 2.0636
234 I A 3.1976
235 S A 1.9711
236 Y A 2.4976
237 Y A 2.9159
238 F A 2.7543
239 N A 0.7744
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.0804 7.3033 View CSV PDB
4.5 -0.1516 7.3033 View CSV PDB
5.0 -0.2371 7.3033 View CSV PDB
5.5 -0.3182 7.3033 View CSV PDB
6.0 -0.3754 7.3033 View CSV PDB
6.5 -0.3997 7.3033 View CSV PDB
7.0 -0.3986 7.3033 View CSV PDB
7.5 -0.385 7.3033 View CSV PDB
8.0 -0.3651 7.3032 View CSV PDB
8.5 -0.3392 7.3029 View CSV PDB
9.0 -0.3073 7.302 View CSV PDB