Project name: AlaVal_R5

Status: done

Started: 2026-08-20 09:25:56
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYVARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:40)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/d85b791f57ce133/tmp/folded.pdb                (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:42)
Show buried residues

Minimal score value
-2.6559
Maximal score value
2.1435
Average score
-0.5469
Total score value
-135.6263

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5318
2 V A -1.0256
3 Q A -1.5481
4 L A 0.0000
5 Q A -1.7279
6 E A 0.0000
7 S A -0.6675
8 G A -0.4069
9 P A -0.0845
10 G A 0.1857
11 L A 0.6292
12 V A 0.0000
13 K A -1.6145
14 P A -1.2520
15 S A -1.3533
16 Q A -1.8375
17 T A -1.4916
18 L A 0.0000
19 S A -0.8413
20 L A 0.0000
21 T A -0.5810
22 A A 0.0000
23 T A -1.1561
24 V A 0.0000
25 S A -1.1808
26 G A -1.2164
27 G A -0.9452
28 S A -0.6955
29 I A 0.0000
30 S A -0.3014
31 S A -0.2344
32 G A -0.1380
33 D A 0.2187
34 Y A 0.7195
35 Y A 0.7181
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.7586
43 P A -0.6760
44 G A -1.1261
45 C A -1.2231
46 K A -2.0392
47 G A -1.2643
48 L A 0.0000
49 E A -0.7470
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1937
54 I A 0.0000
55 Y A 0.4187
56 Y A 0.3797
57 S A -0.0917
58 G A -0.1866
59 S A -0.1849
60 T A -0.1537
61 D A -0.5779
62 Y A -0.7267
63 N A -0.9776
64 P A -1.3823
65 S A -1.2749
66 L A 0.0000
67 K A -2.1386
68 S A -1.4497
69 R A -1.6163
70 V A 0.0000
71 T A -1.0102
72 M A 0.0000
73 S A -0.3406
74 V A -0.3589
75 D A -1.2084
76 T A -1.0583
77 S A -1.3514
78 K A -2.1724
79 N A -1.4433
80 Q A -1.2682
81 F A 0.0000
82 S A -0.4723
83 L A 0.0000
84 K A -1.3147
85 V A 0.0000
86 N A -1.7036
87 S A -1.4762
88 V A 0.0000
89 T A -0.6852
90 A A -0.3843
91 A A -0.3362
92 D A 0.0000
93 T A 0.2477
94 A A 0.0000
95 V A 0.2344
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 A A 0.0000
100 R A -0.0534
101 V A 0.0000
102 S A 0.8597
103 I A 1.6800
104 F A 2.1435
105 G A 0.9504
106 V A 0.8595
107 G A 0.5895
108 T A 0.0000
109 F A 0.0000
110 D A -0.6966
111 Y A -0.3162
112 W A -0.7335
113 G A 0.0000
114 Q A -1.5852
115 G A -0.7538
116 T A -0.1680
117 L A 0.8100
118 V A 0.0000
119 T A 0.2504
120 V A 0.0000
121 S A -0.3374
122 S A -0.7193
123 A A -0.5680
124 A A -0.3596
125 G A -0.8407
126 G A -1.0874
127 G A -1.1513
128 G A -1.1996
129 S A -1.0130
130 G A -1.1681
131 G A -1.2038
132 G A -1.1927
133 G A -1.2529
134 S A -1.0860
135 G A -1.2813
136 G A -1.3993
137 G A -1.3148
138 G A -1.2496
139 S A -0.9256
140 D A -1.0361
141 I A 0.0000
142 V A 0.9684
143 M A 0.0000
144 T A -0.6499
145 Q A -0.6748
146 S A -0.7405
147 P A -0.3525
148 A A -0.3526
149 T A -0.4550
150 L A -0.1893
151 S A -0.3460
152 L A -0.6536
153 S A -0.9660
154 P A -1.4299
155 G A -1.7664
156 E A -2.3430
157 R A -2.6559
158 A A 0.0000
159 T A -0.6632
160 L A 0.0000
161 S A -0.9801
162 A A 0.0000
163 R A -2.4020
164 A A 0.0000
165 S A -0.8151
166 Q A -1.2905
167 S A -1.1385
168 V A 0.0000
169 S A -0.5142
170 S A -0.3780
171 Y A 0.5509
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.2818
179 P A -0.8210
180 G A -0.9559
181 C A -1.1237
182 Q A -1.5529
183 A A -1.1267
184 P A 0.0000
185 R A -1.3948
186 L A -0.7021
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5702
190 D A -0.7296
191 A A 0.0000
192 S A -1.2902
193 N A -1.9783
194 R A -1.9955
195 A A -1.2315
196 T A -0.7184
197 G A -0.7012
198 I A 0.0000
199 P A -0.4841
200 A A -0.4272
201 R A -0.7153
202 F A 0.0000
203 S A -0.8823
204 G A -0.9130
205 S A -0.9672
206 G A -1.2754
207 S A -1.1008
208 G A -1.1241
209 T A -1.8664
210 D A -2.6200
211 F A 0.0000
212 T A -0.8932
213 L A 0.0000
214 T A -0.6103
215 I A 0.0000
216 S A -1.3398
217 S A -1.7051
218 L A 0.0000
219 E A -2.1059
220 P A -1.3178
221 E A -2.0050
222 D A 0.0000
223 F A -0.5805
224 A A 0.0000
225 V A -0.5601
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.2201
232 G A -0.0359
233 S A -0.2774
234 T A -0.4131
235 P A -0.4661
236 L A 0.0000
237 T A 0.1334
238 F A 0.2303
239 G A 0.0000
240 G A -0.8287
241 G A -0.7827
242 T A 0.0000
243 K A -0.9849
244 A A 0.0000
245 E A -0.4438
246 I A 0.7873
247 K A -0.8920
248 A A -0.3523
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.48 4.9558 View CSV PDB
4.5 -0.5019 4.9537 View CSV PDB
5.0 -0.5271 4.9482 View CSV PDB
5.5 -0.5504 4.9355 View CSV PDB
6.0 -0.5658 4.9142 View CSV PDB
6.5 -0.5688 4.8867 View CSV PDB
7.0 -0.5593 4.8564 View CSV PDB
7.5 -0.5416 4.825 View CSV PDB
8.0 -0.5191 4.7932 View CSV PDB
8.5 -0.493 4.7614 View CSV PDB
9.0 -0.4634 4.7298 View CSV PDB