Project name: da21e79ffc0ad3b

Status: done

Started: 2025-02-21 07:22:08
Chain sequence(s) A: MAEENQNKYEETTATNSETEIKDRGVFDFLGGKKKDEEHIKPQEDAVATDFSHKVTLYEAPSETKVEEKEEGEKKHTSLLEKLHRSDSSSSSSSEEEVDGERRKKKKKEKKEKKEDTSVPVEKVDVVDGTTASTEEKKGFLDKIKEKLPGHKKTDDVTTPPPVVVAPAVPSAETTTTTASHDQGEKKGILEKIKEKIPGYHPKTATEHEDNKDHHKDETTSH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-4.7122
Maximal score value
3.5189
Average score
-1.6854
Total score value
-374.1686

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6746
2 A A -0.9149
3 E A -2.9470
4 E A -3.8044
5 N A -3.8209
6 Q A -3.5322
7 N A -3.1459
8 K A -2.9395
9 Y A -1.3837
10 E A -2.7199
11 E A -2.6085
12 T A -1.3119
13 T A -1.0498
14 A A -0.6767
15 T A -1.0037
16 N A -1.9691
17 S A -1.9713
18 E A -2.6210
19 T A -1.7140
20 E A -2.2319
21 I A -0.7603
22 K A -2.7194
23 D A -3.0335
24 R A -2.4929
25 G A -0.6648
26 V A 2.0788
27 F A 2.3278
28 D A 0.0641
29 F A 2.3876
30 L A 2.1129
31 G A -0.3269
32 G A -1.5710
33 K A -3.2617
34 K A -4.1625
35 K A -4.5535
36 D A -4.6432
37 E A -4.1567
38 E A -3.6134
39 H A -1.9405
40 I A -0.1751
41 K A -1.8748
42 P A -2.0468
43 Q A -2.9002
44 E A -3.3062
45 D A -2.5889
46 A A -0.6176
47 V A 0.8876
48 A A 0.4596
49 T A -0.1307
50 D A -0.8045
51 F A 0.4316
52 S A -0.5254
53 H A -1.1176
54 K A -0.9528
55 V A 1.1892
56 T A 1.0579
57 L A 2.0356
58 Y A 1.3607
59 E A -0.9140
60 A A -0.7694
61 P A -1.0250
62 S A -1.4139
63 E A -2.3859
64 T A -1.4421
65 K A -1.7130
66 V A -0.4103
67 E A -2.5153
68 E A -3.7511
69 K A -4.5147
70 E A -4.4453
71 E A -4.2376
72 G A -3.5828
73 E A -4.2209
74 K A -4.0340
75 K A -3.6749
76 H A -2.5909
77 T A -1.4877
78 S A -0.2712
79 L A 1.1589
80 L A 1.1588
81 E A -1.6049
82 K A -1.5042
83 L A -0.0545
84 H A -2.2726
85 R A -3.0061
86 S A -2.1783
87 D A -2.7879
88 S A -1.7110
89 S A -1.1074
90 S A -0.7844
91 S A -0.5656
92 S A -0.5563
93 S A -1.1037
94 S A -1.6838
95 E A -3.0978
96 E A -3.4096
97 E A -2.8068
98 V A -0.9366
99 D A -2.2585
100 G A -2.5553
101 E A -3.5858
102 R A -4.1413
103 R A -4.5447
104 K A -4.1569
105 K A -4.1649
106 K A -4.3278
107 K A -4.1118
108 K A -4.3218
109 E A -4.4336
110 K A -4.1767
111 K A -4.5847
112 E A -4.7122
113 K A -4.5185
114 K A -4.5919
115 E A -4.2937
116 D A -3.2477
117 T A -1.1897
118 S A 0.1313
119 V A 1.4864
120 P A 0.5790
121 V A 0.9511
122 E A -1.3485
123 K A -1.6007
124 V A 0.4994
125 D A -0.6039
126 V A 1.4525
127 V A 1.2949
128 D A -0.9838
129 G A -0.8064
130 T A -0.3472
131 T A -1.0550
132 A A -1.3027
133 S A -1.7842
134 T A -2.5693
135 E A -3.5521
136 E A -3.6291
137 K A -3.3670
138 K A -3.4304
139 G A -2.3427
140 F A -0.5908
141 L A -0.9417
142 D A -2.7490
143 K A -2.2742
144 I A -0.7206
145 K A -2.1006
146 E A -3.3909
147 K A -2.4778
148 L A -0.8600
149 P A -0.9889
150 G A -1.8749
151 H A -2.8632
152 K A -3.5512
153 K A -3.7161
154 T A -2.5597
155 D A -3.0769
156 D A -2.0895
157 V A 0.4146
158 T A 0.0834
159 T A 0.0922
160 P A -0.2858
161 P A -0.1348
162 P A 0.8399
163 V A 2.7734
164 V A 3.5189
165 V A 3.0873
166 A A 1.1649
167 P A 0.6887
168 A A 0.8067
169 V A 1.5585
170 P A 0.6740
171 S A -0.2919
172 A A -1.1016
173 E A -1.8825
174 T A -0.9766
175 T A -0.5669
176 T A -0.1691
177 T A -0.1639
178 T A -0.2633
179 A A -0.3174
180 S A -1.2458
181 H A -2.2571
182 D A -3.4178
183 Q A -3.2037
184 G A -3.3064
185 E A -3.8885
186 K A -3.7440
187 K A -3.0505
188 G A -0.5842
189 I A 1.5613
190 L A 1.4141
191 E A -1.1959
192 K A -1.2846
193 I A 1.0564
194 K A -0.6518
195 E A -2.3175
196 K A -1.7941
197 I A 0.0871
198 P A -0.5168
199 G A -0.6911
200 Y A -0.5773
201 H A -1.8895
202 P A -1.7601
203 K A -2.4724
204 T A -1.3623
205 A A -1.0289
206 T A -1.8453
207 E A -3.4694
208 H A -3.8793
209 E A -4.2718
210 D A -4.4900
211 N A -4.1629
212 K A -4.3228
213 D A -4.1312
214 H A -3.6341
215 H A -3.6571
216 K A -3.9602
217 D A -4.0755
218 E A -3.4421
219 T A -1.7656
220 T A -1.0615
221 S A -0.7439
222 H A -1.1183
Download PDB file
View in 3Dmol