Project name: VAAA_R2

Status: done

Started: 2026-08-21 04:38:11
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/da2acad29a1f02c/tmp/folded.pdb                (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:05)
Show buried residues

Minimal score value
-2.7448
Maximal score value
1.9679
Average score
-0.5692
Total score value
-141.1615

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6923
2 V A 0.0000
3 Q A -2.0806
4 L A 0.0000
5 Q A -1.8596
6 E A 0.0000
7 S A -0.6997
8 G A -0.4123
9 P A -0.0310
10 G A 0.2857
11 L A 0.7941
12 V A 0.0000
13 K A -1.7087
14 P A -1.2809
15 S A -1.3787
16 Q A -1.8980
17 T A -1.5881
18 L A 0.0000
19 S A -1.0046
20 L A 0.0000
21 T A -0.6370
22 V A 0.0000
23 T A -1.2415
24 V A 0.0000
25 S A -1.3876
26 G A -1.4126
27 G A -1.0847
28 S A -0.7335
29 I A 0.0000
30 S A -0.2851
31 S A -0.3527
32 G A -0.1874
33 D A -0.1560
34 Y A 0.5326
35 Y A 0.5800
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2537
41 Q A 0.0000
42 P A -0.6554
43 P A -0.6647
44 G A -1.1212
45 C A -1.2415
46 K A -2.0917
47 G A -1.2609
48 L A 0.0000
49 E A -0.7796
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1715
54 I A 0.0000
55 Y A 0.3035
56 Y A 0.2985
57 S A -0.1211
58 G A -0.2306
59 S A -0.2523
60 T A -0.2389
61 D A -0.6964
62 Y A -0.7003
63 N A -0.9207
64 P A -1.2021
65 S A -1.0213
66 L A 0.0000
67 K A -2.0950
68 S A -1.4136
69 R A -1.6678
70 V A 0.0000
71 T A -1.1303
72 M A 0.0000
73 S A -0.3854
74 V A -0.3568
75 D A -1.1843
76 T A -1.0369
77 S A -1.3266
78 K A -2.1670
79 N A -1.4408
80 Q A -1.2623
81 F A 0.0000
82 S A -0.5622
83 L A 0.0000
84 K A -1.6449
85 V A 0.0000
86 N A -1.7544
87 S A -1.5132
88 V A 0.0000
89 T A -0.6464
90 A A -0.3195
91 A A -0.1508
92 D A 0.0000
93 T A 0.2505
94 A A 0.0000
95 V A 0.1889
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7306
103 I A 1.4492
104 F A 1.9679
105 G A 0.8131
106 V A 0.8601
107 G A 0.7322
108 T A 0.0000
109 F A 0.0000
110 D A -0.5981
111 Y A -0.6362
112 W A -0.8424
113 G A 0.0000
114 Q A -1.6392
115 G A -0.7661
116 T A -0.1865
117 L A 0.8396
118 V A 0.0000
119 T A 0.3096
120 V A 0.0000
121 S A -0.3430
122 S A -0.6680
123 A A -0.6183
124 A A -0.3516
125 G A -0.8384
126 G A -1.0808
127 G A -1.1471
128 G A -1.1811
129 S A -1.0208
130 G A -1.1965
131 G A -1.1961
132 G A -1.1936
133 G A -1.2111
134 S A -1.0627
135 G A -1.1972
136 G A -1.3607
137 G A -1.2345
138 G A -1.2644
139 S A -0.9608
140 D A -1.0200
141 I A 0.0000
142 V A 0.9287
143 M A 0.0000
144 T A -0.6069
145 Q A -0.8412
146 S A -0.7023
147 P A -0.3410
148 A A -0.3332
149 T A -0.5096
150 L A -0.4774
151 S A -0.8172
152 L A -1.1835
153 S A -1.6630
154 P A -1.7488
155 G A -1.8293
156 E A -2.4851
157 R A -2.7448
158 A A 0.0000
159 T A -0.6758
160 L A 0.0000
161 S A -0.8757
162 A A 0.0000
163 R A -2.3471
164 A A 0.0000
165 S A -0.8835
166 Q A -1.5190
167 S A -1.1749
168 V A 0.0000
169 S A -0.3764
170 S A -0.0994
171 Y A 0.8867
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4060
179 P A -0.8085
180 G A -0.9839
181 C A -1.1554
182 Q A -1.6036
183 A A -1.1934
184 P A 0.0000
185 R A -1.4937
186 L A -0.6952
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2242
190 D A -0.3285
191 A A 0.0000
192 S A -0.9049
193 N A -1.2660
194 R A -1.4472
195 A A -0.9687
196 T A -0.5973
197 G A -0.6613
198 I A 0.0000
199 P A -0.4404
200 A A -0.3863
201 R A -0.7109
202 F A 0.0000
203 S A -0.6840
204 G A -0.7084
205 S A -0.8034
206 G A -1.1251
207 S A -0.9162
208 G A -1.0164
209 T A -1.7315
210 D A -2.1721
211 F A 0.0000
212 T A -0.7824
213 L A 0.0000
214 T A -0.5975
215 I A 0.0000
216 S A -1.3816
217 S A -1.7577
218 L A 0.0000
219 E A -2.1506
220 P A -1.7648
221 E A -2.1095
222 D A 0.0000
223 F A -0.8366
224 A A 0.0000
225 V A -0.5706
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3556
232 G A 0.0678
233 S A -0.2053
234 T A -0.4060
235 P A -0.2674
236 L A 0.0000
237 T A 0.1486
238 F A 0.2393
239 G A 0.0000
240 G A -0.8196
241 G A -0.7941
242 T A 0.0000
243 K A -1.0879
244 A A 0.0000
245 E A -1.2579
246 I A -1.4378
247 K A -1.7293
248 A A -0.8332
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5242 4.8593 View CSV PDB
4.5 -0.5472 4.8176 View CSV PDB
5.0 -0.5738 4.7676 View CSV PDB
5.5 -0.5979 4.7142 View CSV PDB
6.0 -0.6126 4.6596 View CSV PDB
6.5 -0.6134 4.6046 View CSV PDB
7.0 -0.601 4.5497 View CSV PDB
7.5 -0.5798 4.4953 View CSV PDB
8.0 -0.5536 4.4425 View CSV PDB
8.5 -0.5237 4.3942 View CSV PDB
9.0 -0.4905 4.3559 View CSV PDB