Project name: ok 4

Status: done

Started: 2026-03-17 06:54:51
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYKQKPGLAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQGLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/dbc0bee43f063e5/tmp/folded.pdb                (00:02:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:07)
Show buried residues

Minimal score value
-3.342
Maximal score value
1.2585
Average score
-0.7314
Total score value
-174.7971

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8457
2 I A 0.0000
3 V A 0.6643
4 L A 0.0000
5 T A -0.6122
6 Q A 0.0000
7 S A -0.6905
8 P A -0.2795
9 A A -0.2988
10 T A -0.4005
11 L A -0.2568
12 S A -0.7868
13 L A -1.1585
14 S A -1.9180
15 P A -2.1393
16 G A -2.3236
17 E A -2.9072
18 R A -3.2753
19 A A 0.0000
20 T A -0.6805
21 L A 0.0000
22 S A -0.8976
23 C A 0.0000
24 R A -2.3419
25 A A 0.0000
26 S A -1.0418
27 Q A -1.7371
28 S A -1.3976
29 V A 0.0000
30 S A -0.5141
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3480
37 Q A -0.2559
38 K A -0.4135
39 P A -0.1349
40 G A -0.1604
41 L A 0.4831
42 A A -0.0936
43 P A 0.0000
44 R A -0.6670
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.6398
49 D A -1.1813
50 T A -0.7930
51 S A -0.9260
52 N A -1.1457
53 L A -0.4522
54 A A 0.0000
55 T A -0.3229
56 G A -0.8625
57 I A -0.5666
58 P A -0.9700
59 D A -1.9006
60 R A -1.9268
61 F A 0.0000
62 S A -0.8149
63 G A -0.5868
64 S A -0.8972
65 G A -1.1248
66 S A -1.0579
67 G A -1.2318
68 T A -1.7805
69 D A -2.1924
70 F A 0.0000
71 T A -0.8136
72 L A 0.0000
73 T A -0.8322
74 I A 0.0000
75 S A -2.4242
76 R A -3.3420
77 L A 0.0000
78 E A -2.2607
79 P A -1.8570
80 E A -1.8599
81 D A 0.0000
82 F A -0.7013
83 A A 0.0000
84 V A -0.2578
85 Y A 0.0000
86 Y A -0.1832
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.1221
91 S A -0.3531
92 S A -1.2512
93 N A -1.8512
94 P A -1.5666
95 F A 0.0000
96 T A 0.0000
97 F A 0.2749
98 G A 0.0000
99 Q A -0.9389
100 G A 0.0000
101 T A 0.0000
102 K A -0.8014
103 L A 0.0000
104 E A -1.3203
105 I A -1.7308
106 K A -2.2689
107 G A -1.7994
108 G A -1.9565
109 G A -1.3950
110 G A -1.3147
111 S A -1.0831
112 G A -1.3824
113 G A -1.2127
114 G A -1.2691
115 G A -1.2544
116 S A -1.0283
117 G A -1.2577
118 G A -1.4449
119 G A -1.3921
120 G A -1.3494
121 S A -1.3266
122 Q A -1.8347
123 V A 0.0000
124 Q A -1.4328
125 L A 0.0000
126 V A 0.3907
127 Q A 0.0000
128 S A -0.5329
129 G A -0.5965
130 A A -0.0602
131 E A -0.1251
132 V A 0.9248
133 Q A -0.7549
134 K A -2.0106
135 P A -2.0027
136 G A -1.4291
137 A A -1.1436
138 S A -1.2782
139 V A 0.0000
140 K A -1.8528
141 V A 0.0000
142 S A -0.5782
143 C A 0.0000
144 K A -0.9316
145 A A 0.0000
146 S A -0.7797
147 G A -0.9048
148 Y A -0.6907
149 T A -0.7546
150 F A 0.0000
151 N A -2.0656
152 R A -2.3482
153 Y A -1.2119
154 T A -0.5947
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.3607
161 A A -0.7483
162 P A -0.7159
163 G A -1.2376
164 Q A -1.3101
165 G A -0.6325
166 L A -0.3421
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.4389
171 I A 0.0000
172 N A -0.5698
173 P A 0.0000
174 S A -1.6548
175 R A -1.5222
176 G A -0.2917
177 Y A 1.0533
178 Y A 1.2585
179 N A -0.3984
180 Y A -1.2222
181 A A 0.0000
182 Q A -2.8635
183 K A -2.9239
184 F A 0.0000
185 K A -3.2531
186 D A -3.0880
187 R A -2.1701
188 V A 0.0000
189 T A -0.9506
190 M A 0.0000
191 T A -0.2608
192 R A -1.1662
193 D A -1.2207
194 T A -0.8807
195 S A -0.5763
196 T A -0.6897
197 S A -0.9014
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7797
201 M A 0.0000
202 E A -1.5157
203 L A 0.0000
204 S A -1.2466
205 S A -1.2061
206 L A 0.0000
207 R A -2.4875
208 S A -2.0823
209 E A -2.3503
210 D A 0.0000
211 T A -0.7815
212 A A 0.0000
213 V A 0.1551
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1679
221 D A -2.5343
222 D A -2.5775
223 H A -1.6366
224 Y A -0.6968
225 C A 0.0000
226 L A 0.0000
227 D A -0.2012
228 Y A -0.2035
229 W A -0.1064
230 G A 0.0000
231 Q A -0.7387
232 G A -0.1979
233 T A 0.0000
234 T A 0.0270
235 V A 0.0000
236 T A -0.2438
237 V A 0.0000
238 S A -0.7770
239 S A -0.9180
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7039 2.1291 View CSV PDB
4.5 -0.7444 2.1324 View CSV PDB
5.0 -0.7927 2.1414 View CSV PDB
5.5 -0.8406 2.1615 View CSV PDB
6.0 -0.8799 2.1945 View CSV PDB
6.5 -0.9047 2.2364 View CSV PDB
7.0 -0.9144 2.2823 View CSV PDB
7.5 -0.9131 2.3296 View CSV PDB
8.0 -0.905 2.3772 View CSV PDB
8.5 -0.8908 2.4243 View CSV PDB
9.0 -0.8695 2.4698 View CSV PDB