Project name: dc66e0acb28cf0e

Status: done

Started: 2026-08-13 14:22:01
Chain sequence(s) A: DTESKLPWIPYKGTYGPCMEAVHGDGGREAIEKGCGTEGFCDLLNPVYGPDNLERLSKKYGYANNTECYAAHDKIPWVEYKEDYGACMQAVHSHADREDFEEACGTEGFCDMFNPEYGTESLKRVLETWGQYGFKTHTECYAGHTKKPWVEWKDYGSCHDVAYSVVSREKYEAGCGTETFCDLFNPEYGTDSLERMTKQYGYATVAECIADHEPQPHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:02)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/dc66e0acb28cf0e/tmp/folded.pdb                (00:03:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:06)
Show buried residues

Minimal score value
-3.9767
Maximal score value
2.0328
Average score
-1.1544
Total score value
-256.2835

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -2.4031
2 T A -2.1462
3 E A -2.8806
4 S A -2.3103
5 K A -2.6516
6 L A -1.1330
7 P A -0.9920
8 W A -0.7142
9 I A -0.5609
10 P A -0.5934
11 Y A -0.9075
12 K A -1.7826
13 G A -1.0851
14 T A -0.3520
15 Y A 0.6256
16 G A -0.1561
17 P A -0.9722
18 C A 0.0000
19 M A -0.7186
20 E A -2.1788
21 A A -2.1127
22 V A -1.2014
23 H A -2.0805
24 G A -2.1881
25 D A -2.6470
26 G A -2.0590
27 G A -1.7401
28 R A -2.3620
29 E A -2.7312
30 A A -2.2199
31 I A 0.0000
32 E A 0.0000
33 K A -2.4524
34 G A 0.0000
35 C A 0.0000
36 G A 0.0000
37 T A 0.0000
38 E A -0.1735
39 G A -0.3876
40 F A 0.0000
41 C A 0.0000
42 D A -0.2991
43 L A 0.4301
44 L A 0.0000
45 N A 0.2659
46 P A 0.3719
47 V A 2.0328
48 Y A 1.6516
49 G A 0.0674
50 P A -1.4825
51 D A -2.9822
52 N A -1.8891
53 L A -1.9932
54 E A -3.9767
55 R A -3.9223
56 L A -2.4595
57 S A -2.6676
58 K A -3.1559
59 K A -2.6587
60 Y A 0.0000
61 G A -1.4665
62 Y A 0.0000
63 A A -1.2702
64 N A -1.1001
65 N A -0.8864
66 T A -0.9307
67 E A -1.4482
68 C A 0.0000
69 Y A -0.9426
70 A A -1.0415
71 A A -1.3784
72 H A 0.0000
73 D A -2.4693
74 K A -2.3165
75 I A 0.0000
76 P A -0.7919
77 W A -0.7123
78 V A -0.7695
79 E A -1.6220
80 Y A -2.1396
81 K A -3.2558
82 E A -3.0726
83 D A -1.9333
84 Y A -0.2570
85 G A -0.4630
86 A A -1.2355
87 C A 0.0000
88 M A -0.4344
89 Q A -1.3414
90 A A 0.0000
91 V A -0.8607
92 H A -1.4873
93 S A -1.5238
94 H A -1.9754
95 A A -2.1722
96 D A -2.8142
97 R A 0.0000
98 E A -2.3056
99 D A -3.2214
100 F A 0.0000
101 E A 0.0000
102 E A -2.9225
103 A A -2.1370
104 C A 0.0000
105 G A 0.0000
106 T A 0.0000
107 E A -1.0194
108 G A -0.8585
109 F A 0.0000
110 C A 0.0000
111 D A -1.0350
112 M A -0.5521
113 F A 0.0000
114 N A -1.1065
115 P A -1.4853
116 E A -1.4495
117 Y A -0.0855
118 G A -1.0165
119 T A -1.8161
120 E A -2.7326
121 S A -1.9511
122 L A 0.0000
123 K A -3.8223
124 R A -3.6049
125 V A -2.2677
126 L A -2.4009
127 E A -2.8967
128 T A -2.0270
129 W A 0.0000
130 G A -1.7812
131 Q A -1.4874
132 Y A -1.0375
133 G A -1.3137
134 F A -1.3619
135 K A -2.3354
136 T A -1.6245
137 H A -1.4452
138 T A -1.0257
139 E A -1.6891
140 C A 0.0000
141 Y A -0.6717
142 A A -0.7024
143 G A -1.0121
144 H A 0.0000
145 T A -1.4035
146 K A -1.7568
147 K A 0.0000
148 P A -0.8902
149 W A -0.9015
150 V A -0.8786
151 E A -1.8884
152 W A -1.0743
153 K A -2.0486
154 D A -1.6542
155 Y A -0.2149
156 G A -1.1884
157 S A -1.2806
158 C A 0.0000
159 H A -1.2680
160 D A -1.8191
161 V A 0.0000
162 A A 0.0591
163 Y A 1.1332
164 S A 1.0244
165 V A 1.7694
166 V A 0.5679
167 S A -0.6041
168 R A 0.0000
169 E A -1.6336
170 K A -2.0443
171 Y A 0.0000
172 E A 0.0000
173 A A -0.9154
174 G A 0.0000
175 C A 0.0000
176 G A 0.0000
177 T A 0.0000
178 E A -1.8587
179 T A -0.9921
180 F A 0.0000
181 C A 0.0000
182 D A -0.8428
183 L A -0.3455
184 F A 0.0000
185 N A -0.5043
186 P A -1.1964
187 E A -1.4552
188 Y A -0.0581
189 G A -0.9833
190 T A -1.7550
191 D A -2.6652
192 S A -2.0426
193 L A -2.1954
194 E A -3.6419
195 R A -3.7847
196 M A -2.2761
197 T A -2.3882
198 K A -3.2413
199 Q A -2.2252
200 Y A -1.1809
201 G A -1.6111
202 Y A 0.0000
203 A A -0.6720
204 T A -0.1749
205 V A -0.0718
206 A A -0.1722
207 E A -0.9504
208 C A 0.0000
209 I A -0.2716
210 A A -0.5756
211 D A -1.2249
212 H A 0.0000
213 E A -1.3608
214 P A -1.1808
215 Q A -1.6896
216 P A -1.7372
217 H A -2.2599
218 H A -2.5996
219 H A -2.7881
220 H A -2.7635
221 H A -2.4406
222 H A -1.9462
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8545 3.0969 View CSV PDB
4.5 -0.9637 3.0872 View CSV PDB
5.0 -1.0996 3.0766 View CSV PDB
5.5 -1.2343 3.0657 View CSV PDB
6.0 -1.3381 3.0546 View CSV PDB
6.5 -1.3935 3.0436 View CSV PDB
7.0 -1.405 3.0326 View CSV PDB
7.5 -1.3897 3.0218 View CSV PDB
8.0 -1.3607 3.0115 View CSV PDB
8.5 -1.3209 3.0026 View CSV PDB
9.0 -1.2681 2.9952 View CSV PDB