Project name: Vobarilizumab

Status: done

Started: 2026-06-23 07:33:04
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGSVFKINVMAWYRQAPGKGRELVAGIISGGSTSYADSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCAFITTESDYDLGRRYWGQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/dcc991218e3d3df/tmp/folded.pdb                (00:02:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:09)
Show buried residues

Minimal score value
-2.6506
Maximal score value
1.5746
Average score
-0.7111
Total score value
-174.2206

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1445
2 V A -1.3599
3 Q A -1.1850
4 L A 0.0000
5 V A 1.3071
6 E A 0.5597
7 S A -0.1295
8 G A -0.8733
9 G A -0.4274
10 G A 0.0000
11 L A -0.0543
12 V A 0.0000
13 Q A -1.9406
14 P A -1.8035
15 G A -1.4066
16 G A -1.0633
17 S A -1.1713
18 L A -1.0222
19 R A -2.0906
20 L A 0.0000
21 S A -0.3969
22 C A 0.0000
23 A A -0.0899
24 A A 0.0000
25 S A -1.0171
26 G A -1.4407
27 S A -1.1550
28 V A 0.0000
29 F A 0.0000
30 K A -2.0194
31 I A -1.0617
32 N A -1.1187
33 V A -0.0257
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A -0.2795
38 R A 0.0000
39 Q A -1.4302
40 A A -1.6043
41 P A -1.3357
42 G A -1.6528
43 K A -2.5602
44 G A -2.0959
45 R A -1.8817
46 E A -1.6828
47 L A -0.1838
48 V A 0.0000
49 A A 0.0000
50 G A 0.2073
51 I A 0.0000
52 I A 0.0258
53 S A -0.8974
54 G A -0.6734
55 G A -0.6786
56 S A -0.3722
57 T A -0.1876
58 S A -0.4669
59 Y A -0.8734
60 A A -1.3603
61 D A -2.4546
62 S A -1.6771
63 V A 0.0000
64 K A -2.5414
65 G A -1.6134
66 R A 0.0000
67 F A 0.0000
68 T A -0.8321
69 I A 0.0000
70 S A -0.5512
71 R A -1.2138
72 D A -1.9428
73 N A -2.5026
74 A A -1.6852
75 K A -2.4610
76 N A -2.0945
77 T A 0.0000
78 L A 0.0000
79 Y A -0.6686
80 L A 0.0000
81 Q A -1.2454
82 M A 0.0000
83 N A -1.2877
84 S A -1.1079
85 L A 0.0000
86 R A -2.3176
87 P A -1.9604
88 E A -2.3367
89 D A 0.0000
90 T A -0.9034
91 A A 0.0000
92 V A 0.0000
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 F A 0.0000
98 I A -0.4814
99 T A -1.5526
100 T A -1.8390
101 E A -2.6506
102 S A -1.8633
103 D A -1.8942
104 Y A -0.4149
105 D A -1.7514
106 L A -0.1346
107 G A -1.5055
108 R A -2.5121
109 R A -1.4262
110 Y A -0.6235
111 W A 0.2546
112 G A 0.2883
113 Q A -0.2908
114 G A 0.0000
115 T A 0.0106
116 L A 0.0000
117 V A 0.0000
118 T A 0.0000
119 V A 0.0000
120 S A -1.2139
121 S A -1.1071
122 G A -0.8488
123 G A -1.3141
124 G A -1.2398
125 G A -1.2823
126 S A -1.0291
127 G A -1.2113
128 G A -1.3270
129 G A -1.2334
130 S A -1.3824
131 E A -1.8649
132 V A -0.7234
133 Q A -1.1145
134 L A 0.0000
135 V A 0.4705
136 E A 0.0000
137 S A -0.2948
138 G A -0.7310
139 G A 0.1377
140 G A 0.8211
141 L A 1.3430
142 V A 0.0000
143 Q A -1.7285
144 P A -1.9807
145 G A -1.9039
146 N A -2.1397
147 S A -1.7267
148 L A -1.2427
149 R A -2.0054
150 L A 0.0000
151 S A -0.4444
152 C A 0.0000
153 A A -0.1550
154 A A 0.0000
155 S A -0.5254
156 G A -0.7007
157 F A -0.2835
158 T A -0.1993
159 F A 0.0000
160 S A -0.5393
161 S A -0.4277
162 F A 0.0000
163 G A -0.2974
164 M A 0.0000
165 S A 0.0000
166 W A 0.0000
167 V A 0.0000
168 R A 0.0000
169 Q A -0.5651
170 A A -1.0273
171 P A -1.1307
172 G A -1.4838
173 K A -2.1705
174 G A -0.8934
175 L A 0.2993
176 E A -0.1588
177 W A 0.0000
178 V A 0.0000
179 S A 0.0000
180 S A 0.0000
181 I A 0.0000
182 S A -0.6434
183 G A -0.6431
184 S A -0.7796
185 G A -0.9000
186 S A -0.8530
187 D A -1.1979
188 T A -0.5440
189 L A -0.7013
190 Y A -0.7933
191 A A 0.0000
192 D A -2.4643
193 S A -1.6936
194 V A 0.0000
195 K A -2.4845
196 G A -1.6274
197 R A 0.0000
198 F A 0.0000
199 T A -0.7692
200 I A 0.0000
201 S A -0.5010
202 R A -0.9048
203 D A -1.3324
204 N A -1.4510
205 A A -1.1995
206 K A -2.0150
207 T A -1.1842
208 T A -0.7652
209 L A 0.0000
210 Y A -0.5051
211 L A 0.0000
212 Q A -1.1676
213 M A 0.0000
214 N A -1.6245
215 S A -1.4903
216 L A 0.0000
217 R A -2.4825
218 P A -1.9835
219 E A -2.3444
220 D A 0.0000
221 T A -0.4994
222 A A 0.0000
223 V A 0.8059
224 Y A 0.0000
225 Y A 0.1768
226 C A 0.0000
227 T A 0.0000
228 I A 0.0000
229 G A 0.0000
230 G A 0.0000
231 S A -0.2397
232 L A 0.1572
233 S A -0.7609
234 R A -1.6994
235 S A -0.9268
236 S A -0.8529
237 Q A -0.8454
238 G A -0.0762
239 T A 0.5262
240 L A 1.5746
241 V A 0.0000
242 T A 0.2908
243 V A 0.0000
244 S A -0.7707
245 S A -0.5611
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6612 2.0854 View CSV PDB
4.5 -0.7037 2.0854 View CSV PDB
5.0 -0.7532 2.0854 View CSV PDB
5.5 -0.8017 2.0854 View CSV PDB
6.0 -0.8402 2.0854 View CSV PDB
6.5 -0.8618 2.0854 View CSV PDB
7.0 -0.8668 2.0854 View CSV PDB
7.5 -0.8608 2.0854 View CSV PDB
8.0 -0.8484 2.0854 View CSV PDB
8.5 -0.8305 2.0854 View CSV PDB
9.0 -0.8061 2.0854 View CSV PDB