Project name: 53ad7cd6341d365 [mutate: MA252A, TA260A, LA309A, PA396A, VA397A]

Status: done

Started: 2026-03-28 14:11:43
Chain sequence(s) A: GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
B: GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues VA397A,PA396A,TA260A,MA252A,LA309A
Energy difference between WT (input) and mutated protein (by FoldX) 6.01048 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:02:30)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:15)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/dd5ae3197819bc7/tmp/folded.pdb                (00:03:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:04)
Show buried residues

Minimal score value
-3.4879
Maximal score value
1.5998
Average score
-0.8893
Total score value
-368.1643

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
237 G A -0.9283
238 P A 0.0000
239 S A -0.1635
240 V A 0.0000
241 F A 1.1912
242 L A 0.0000
243 F A 1.3470
244 P A -0.0144
245 P A 0.0000
246 K A -2.2146
247 P A -1.6569
248 K A -1.7817
249 D A -1.7347
250 T A 0.0000
251 L A 0.0000
252 A A -0.1376 mutated: MA252A
253 I A 0.8745
254 S A -0.2700
255 R A -1.6720
256 T A -1.2557
257 P A 0.0000
258 E A -1.3140
259 V A 0.0000
260 A A 0.3093 mutated: TA260A
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.5465
265 D A -1.8190
266 V A 0.0000
267 S A -2.1682
268 H A -2.4795
269 E A -2.9505
270 D A -2.6059
271 P A -2.6902
272 E A -2.8652
273 V A -1.7407
274 K A -2.1564
275 F A -1.1274
276 N A -1.1301
277 W A 0.0000
278 Y A -0.6930
279 V A -1.0020
280 D A -2.0842
281 G A -0.8853
282 V A 0.7022
283 E A -0.6550
284 V A -0.4889
285 H A -1.8495
286 N A -2.1653
287 A A -1.8836
288 K A -2.4328
289 T A -1.7454
290 K A -2.4616
291 P A -2.4083
292 R A -3.4879
293 E A -3.3821
294 E A -2.1905
295 Q A -1.5764
296 Y A -0.0269
297 N A -1.1610
298 S A -1.0231
299 T A 0.0000
300 Y A 0.0000
301 R A -2.2944
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A 0.0000
306 L A 0.0000
307 T A -0.9560
308 V A 0.0000
309 A A -0.6619 mutated: LA309A
310 H A -0.9778
311 Q A -1.6791
312 D A -1.8790
313 W A 0.0000
314 L A -1.2383
315 N A -2.2883
316 G A -2.1465
317 K A -2.4417
318 E A -2.5066
319 Y A 0.0000
320 K A -1.7806
321 C A 0.0000
322 K A -1.5857
323 V A 0.0000
324 S A -1.4302
325 N A 0.0000
326 K A -2.5333
327 A A -1.4092
328 L A -0.5970
329 P A -0.5120
330 A A -0.4327
331 P A -0.9079
332 I A -0.8013
333 E A -2.1310
334 K A -1.2480
335 T A -1.0541
336 I A -0.1222
337 S A -0.9842
338 K A -1.3603
339 A A -1.1960
340 K A -2.3265
341 G A -2.0382
342 Q A -2.0407
343 P A -1.9242
344 R A -2.3958
345 E A -2.5874
346 P A 0.0000
347 Q A -0.8739
348 V A 0.0000
349 Y A 0.0000
350 T A -0.4953
351 L A 0.0000
352 P A -0.1118
353 P A 0.0000
354 S A -1.2952
355 R A -2.3409
356 E A -2.0344
357 E A 0.0000
358 M A -1.5511
359 T A -1.2125
360 K A -1.7312
361 N A -2.3052
362 Q A -2.2051
363 V A 0.0000
364 S A 0.0000
365 L A 0.0000
366 T A 0.0000
367 C A 0.0000
368 L A 0.0000
369 V A 0.0000
370 K A -0.3883
371 G A 0.0000
372 F A 0.0000
373 Y A -1.2291
374 P A 0.0000
375 S A -0.2816
376 D A -1.2396
377 I A -0.6050
378 A A -0.5173
379 V A -0.2744
380 E A -1.2514
381 W A 0.0000
382 E A -1.7338
383 S A 0.0000
384 N A -1.8045
385 G A -1.8614
386 Q A -2.2787
387 P A -1.9813
388 E A -1.9360
389 N A -2.2344
390 N A -1.8154
391 Y A -1.1212
392 K A -0.8498
393 T A -0.2728
394 T A 0.0000
395 P A -0.1207
396 A A 0.1671 mutated: PA396A
397 A A 0.5462 mutated: VA397A
398 L A 0.9914
399 D A -0.3205
400 S A -1.1633
401 D A -1.9093
402 G A -1.0514
403 S A 0.0000
404 F A 0.1518
405 F A 0.0000
406 L A 0.0000
407 Y A 0.0000
408 S A 0.0000
409 K A 0.0000
410 L A 0.0000
411 T A -0.9719
412 V A 0.0000
413 D A -2.4881
414 K A -2.5149
415 S A -2.1781
416 R A -2.0034
417 W A 0.0000
418 Q A -2.0662
419 Q A -1.8922
420 G A -0.6884
421 N A -0.3966
422 V A 0.8242
423 F A 0.0000
424 S A -0.6201
425 C A 0.0000
426 S A 0.0000
427 V A 0.0000
428 M A -0.3948
429 H A 0.0000
430 E A -1.1156
431 A A -1.6140
432 L A -1.4004
433 H A -1.7135
434 N A -1.4282
435 H A -0.8923
436 Y A -0.2153
437 T A -0.4637
438 Q A -0.7939
439 K A -0.8046
440 S A -0.2997
441 L A 0.0000
442 S A 0.6640
443 L A 1.1075
237 G B -0.8653
238 P B 0.0000
239 S B -0.0610
240 V B 0.0000
241 F B 1.3221
242 L B 0.0000
243 F B 1.2974
244 P B -0.0276
245 P B 0.0000
246 K B -2.0384
247 P B -1.3647
248 K B -1.0423
249 D B -1.1147
250 T B 0.0000
251 L B 0.0000
252 M B 0.5107
253 I B 1.5998
254 S B 0.2700
255 R B -0.6779
256 T B -0.5270
257 P B 0.0000
258 E B -0.9368
259 V B 0.0000
260 T B 0.3104
261 C B 0.0000
262 V B 0.0000
263 V B 0.0000
264 V B -0.2989
265 D B -1.4996
266 V B 0.0000
267 S B -1.8745
268 H B -2.0019
269 E B -2.7324
270 D B -2.4448
271 P B -2.5393
272 E B -2.8558
273 V B -1.7462
274 K B -2.1732
275 F B -1.1042
276 N B -1.0815
277 W B 0.0000
278 Y B -0.6495
279 V B -0.9591
280 D B -2.0619
281 G B -0.8662
282 V B 0.7169
283 E B -0.6352
284 V B -0.4659
285 H B -1.8434
286 N B -2.1618
287 A B -1.8655
288 K B -2.4254
289 T B -1.7299
290 K B -2.4325
291 P B -2.3981
292 R B -3.4408
293 E B -3.3169
294 E B -2.0750
295 Q B -1.4390
296 Y B 0.0252
297 N B -1.1025
298 S B -0.8804
299 T B -1.4545
300 Y B -1.8626
301 R B -2.1029
302 V B 0.0000
303 V B 0.0000
304 S B 0.0000
305 V B 0.0000
306 L B 0.0000
307 T B -0.6415
308 V B 0.0000
309 L B 0.5981
310 H B -0.1855
311 Q B -1.1920
312 D B -1.3209
313 W B 0.0000
314 L B -1.0284
315 N B -2.1176
316 G B -2.1093
317 K B -2.3380
318 E B -2.4406
319 Y B 0.0000
320 K B -1.6110
321 C B 0.0000
322 K B -1.4489
323 V B 0.0000
324 S B -1.4158
325 N B 0.0000
326 K B -2.5334
327 A B -1.3947
328 L B -0.5611
329 P B -0.5171
330 A B -0.4169
331 P B -0.8735
332 I B -0.7146
333 E B -1.9252
334 K B -1.0959
335 T B -0.9428
336 I B -0.1050
337 S B -0.9728
338 K B -1.3403
339 A B -1.2029
340 K B -2.3194
341 G B -2.0224
342 Q B -2.0408
343 P B -1.9530
344 R B -2.4366
345 E B -2.6115
346 P B 0.0000
347 Q B -0.9551
348 V B 0.0000
349 Y B 0.0000
350 T B -0.5954
351 L B 0.0000
352 P B -0.2226
353 P B -0.6784
354 S B 0.0000
355 R B -1.9729
356 E B -1.3461
357 E B 0.0000
358 M B -1.3069
359 T B -1.1869
360 K B -1.8949
361 N B -2.4226
362 Q B -2.3926
363 V B 0.0000
364 S B 0.0000
365 L B 0.0000
366 T B 0.0000
367 C B 0.0000
368 L B 0.0000
369 V B 0.0000
370 K B -0.4133
371 G B 0.0000
372 F B 0.0000
373 Y B -1.2712
374 P B 0.0000
375 S B -0.3151
376 D B -1.1814
377 I B -0.5155
378 A B -0.4096
379 V B -0.3832
380 E B -1.4527
381 W B 0.0000
382 E B -1.8252
383 S B -1.2461
384 N B -1.8479
385 G B -1.7460
386 Q B -2.2799
387 P B -2.0154
388 E B -1.9811
389 N B -2.2972
390 N B -1.9080
391 Y B -1.2057
392 K B -0.8692
393 T B -0.3109
394 T B 0.0000
395 P B -0.1680
396 P B 0.0817
397 V B 0.5246
398 L B 0.6877
399 D B -0.4249
400 S B -1.1934
401 D B -1.9500
402 G B -1.1208
403 S B 0.0000
404 F B 0.0567
405 F B 0.0000
406 L B 0.0000
407 Y B 0.0000
408 S B 0.0000
409 K B 0.0000
410 L B 0.0000
411 T B -0.9864
412 V B 0.0000
413 D B -2.8959
414 K B -2.9887
415 S B -2.7955
416 R B -3.1631
417 W B 0.0000
418 Q B -2.5790
419 Q B -2.3460
420 G B -0.9980
421 N B -0.9104
422 V B 0.3339
423 F B 0.0000
424 S B 0.0000
425 C B 0.0000
426 S B 0.0000
427 V B 0.0000
428 M B -0.3291
429 H B 0.0000
430 E B -1.1240
431 A B -1.6099
432 L B -1.4181
433 H B -1.7176
434 N B -1.5907
435 H B -1.0049
436 Y B -0.2916
437 T B -0.6066
438 Q B -1.0615
439 K B -0.8936
440 S B -0.4073
441 L B 0.0000
442 S B 0.3333
443 L B 1.1688
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7573 3.9105 View CSV PDB
4.5 -0.8201 3.8904 View CSV PDB
5.0 -0.8955 3.8738 View CSV PDB
5.5 -0.9666 3.8737 View CSV PDB
6.0 -1.0159 3.8995 View CSV PDB
6.5 -1.0325 3.9507 View CSV PDB
7.0 -1.0191 4.0194 View CSV PDB
7.5 -0.9882 4.0966 View CSV PDB
8.0 -0.9491 4.1768 View CSV PDB
8.5 -0.9044 4.2573 View CSV PDB
9.0 -0.8537 4.3356 View CSV PDB