Project name: ddbc2b6a54fdb95

Status: done

Started: 2025-02-21 06:54:06
Chain sequence(s) A: MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGGGGGGRYGGGGGGGGGRYGGGGAYGQRRDDGYGDDGYGGGRGYGGGRYGGGRGYGGRRDGGYGRGGNSDGY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.4215
Maximal score value
0.6621
Average score
-1.5383
Total score value
-249.2117

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5573
2 A A -0.6399
3 E A -2.1041
4 S A -1.9702
5 D A -2.6903
6 G A -2.1581
7 A A -1.9585
8 E A -2.5322
9 Y A -1.9276
10 R A -1.6628
11 C A 0.0000
12 F A -0.2323
13 V A 0.0000
14 G A 0.0000
15 S A -0.2784
16 L A 0.0000
17 S A 0.0000
18 W A -0.8550
19 N A -1.6585
20 T A -1.8665
21 D A -3.5382
22 D A -3.7434
23 R A -3.7668
24 G A -2.7499
25 L A 0.0000
26 E A -3.1871
27 A A -1.3684
28 A A -0.8356
29 F A 0.0000
30 S A -1.0035
31 S A -0.4248
32 F A -0.5905
33 G A -1.5068
34 E A -1.9367
35 I A -0.8564
36 L A -0.1267
37 D A -1.8286
38 A A -2.2329
39 K A -2.5172
40 I A -1.3435
41 I A -1.0766
42 N A -3.1926
43 D A -3.6569
44 R A -3.9594
45 E A -3.4826
46 T A -2.8232
47 G A -3.2182
48 R A -3.5970
49 S A -2.6919
50 R A -2.7221
51 G A 0.0000
52 F A -0.1736
53 G A 0.0000
54 F A -0.1652
55 V A 0.0000
56 S A -1.2161
57 F A 0.0000
58 S A -1.5919
59 N A -2.6560
60 E A -3.4608
61 Q A -2.9544
62 A A 0.0000
63 M A 0.0000
64 Q A -3.5031
65 D A -3.3417
66 A A 0.0000
67 I A -2.4256
68 E A -3.3751
69 G A -2.1954
70 M A -2.0503
71 N A -2.4959
72 G A -2.2696
73 K A -3.3065
74 E A -3.3553
75 L A -2.0569
76 D A -2.6583
77 G A -2.2339
78 R A -2.2030
79 S A -2.1524
80 I A 0.0000
81 V A -0.2018
82 V A 0.0000
83 N A -2.1513
84 E A -2.3104
85 A A 0.0000
86 Q A -2.3782
87 S A -2.0635
88 R A -2.3428
89 G A -1.6108
90 Y A -0.1271
91 G A -0.8471
92 G A -0.7706
93 G A -1.2198
94 G A -1.2251
95 G A -1.2641
96 G A -1.5341
97 R A -1.6881
98 Y A -0.1116
99 G A -0.5848
100 G A -0.9689
101 G A -1.1620
102 G A -1.1623
103 G A -1.1633
104 G A -1.2199
105 G A -1.1645
106 G A -1.4637
107 G A -1.4875
108 R A -1.5616
109 Y A -0.1351
110 G A -0.5922
111 G A -0.7939
112 G A -0.9370
113 G A -0.5972
114 A A 0.0997
115 Y A 0.4372
116 G A -0.8498
117 Q A -2.6907
118 R A -3.6948
119 R A -4.4215
120 D A -4.2885
121 D A -3.0392
122 G A -1.3866
123 Y A 0.0895
124 G A -1.1608
125 D A -2.7793
126 D A -2.7986
127 G A -1.1926
128 Y A 0.2554
129 G A -0.3976
130 G A -1.0087
131 G A -1.6560
132 R A -2.1379
133 G A -0.9278
134 Y A 0.3972
135 G A -0.2190
136 G A -1.0514
137 G A -1.4336
138 R A -1.6224
139 Y A -0.0012
140 G A -0.5550
141 G A -1.0308
142 G A -1.8194
143 R A -2.1205
144 G A -0.9364
145 Y A 0.1831
146 G A -0.7679
147 G A -2.1120
148 R A -3.4506
149 R A -4.1381
150 D A -3.6520
151 G A -1.7258
152 G A -1.0379
153 Y A 0.2278
154 G A -1.0447
155 R A -2.2694
156 G A -1.9551
157 G A -2.0018
158 N A -2.3575
159 S A -1.9683
160 D A -2.1893
161 G A -1.0373
162 Y A 0.6621
Download PDB file
View in 3Dmol