Project name: ap1etail

Status: done

Started: 2026-04-20 11:39:09
Chain sequence(s) A: MADVQLQESGGDLVQAGGSLRLSCAASAATYCMYDMKWYRQAPGKGREFVSAIDKNGSTRYSDSVKGRFTISQDYAKNTVYLQMNSLKPEDTAVYYCNCGSYGSTWPWGQGTLVAVVKTVEDAFLALLALEQHLGVQPADLAALAEKLNLSQLLELGELLKAAGHPLAPQVEALLKEKLKAASAAEAAGVIFQALVKDEELGKKILEWAKEFGTEEAKKAIEIAEKAYELYKKYLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:09)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:13)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/de1fdc3b28ce2dd/tmp/folded.pdb                (00:05:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:07)
Show buried residues

Minimal score value
-4.5933
Maximal score value
1.3651
Average score
-1.0521
Total score value
-254.6197

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6427
2 A A -0.2899
3 D A -1.4712
4 V A -0.7752
5 Q A -1.4426
6 L A 0.0000
7 Q A -1.5975
8 E A 0.0000
9 S A -1.2325
10 G A -1.3875
11 G A -1.4147
12 D A -2.1486
13 L A 0.0000
14 V A 0.0000
15 Q A -2.1973
16 A A -1.9968
17 G A -1.4694
18 G A -1.0536
19 S A -1.5360
20 L A -1.5965
21 R A -2.4777
22 L A 0.0000
23 S A -0.8782
24 C A 0.0000
25 A A -0.9855
26 A A 0.0000
27 S A -0.5487
28 A A -0.2869
29 A A 0.0000
30 T A 0.6241
31 Y A 1.3651
32 C A 0.0000
33 M A 0.0000
34 Y A 0.4003
35 D A -0.5509
36 M A 0.0000
37 K A -0.2758
38 W A 0.0000
39 Y A 0.0000
40 R A 0.0000
41 Q A -1.4532
42 A A -1.3478
43 P A -1.1519
44 G A -1.5768
45 K A -2.5471
46 G A -2.0260
47 R A -1.5643
48 E A -1.6034
49 F A -0.4155
50 V A 0.0000
51 S A 0.0000
52 A A 0.0000
53 I A 0.0000
54 D A -1.8764
55 K A -1.7855
56 N A -2.1974
57 G A -1.7852
58 S A -1.6799
59 T A -1.6238
60 R A -2.3684
61 Y A -1.8101
62 S A -1.8278
63 D A -2.6713
64 S A -1.7507
65 V A 0.0000
66 K A -2.8868
67 G A -1.7779
68 R A -1.4355
69 F A 0.0000
70 T A -1.1941
71 I A 0.0000
72 S A -0.5014
73 Q A -0.5999
74 D A -0.6229
75 Y A -0.0043
76 A A -0.5748
77 K A -1.7148
78 N A -0.8324
79 T A 0.0000
80 V A 0.0000
81 Y A -0.6745
82 L A 0.0000
83 Q A -1.6505
84 M A 0.0000
85 N A -1.5152
86 S A -1.1702
87 L A 0.0000
88 K A -2.1812
89 P A -2.0982
90 E A -2.1522
91 D A 0.0000
92 T A 0.0000
93 A A 0.0000
94 V A -0.2517
95 Y A 0.0000
96 Y A -0.4366
97 C A 0.0000
98 N A 0.0000
99 C A 0.3319
100 G A 0.1869
101 S A 0.1758
102 Y A 0.7985
103 G A 0.1318
104 S A 0.1158
105 T A 0.0922
106 W A 0.0910
107 P A -0.4239
108 W A -0.2941
109 G A -1.1347
110 Q A -1.2756
111 G A 0.0000
112 T A 0.0000
113 L A -0.3022
114 V A 0.0000
115 A A 0.0000
116 V A 0.0000
117 V A 0.0000
118 K A -2.6700
119 T A -1.6182
120 V A -1.3200
121 E A -1.9075
122 D A -1.5535
123 A A 0.0000
124 F A 0.2215
125 L A 0.2927
126 A A 0.0000
127 L A 0.0000
128 L A -0.0374
129 A A 0.0000
130 L A -0.5019
131 E A -1.6755
132 Q A -1.5249
133 H A -0.4963
134 L A 0.4248
135 G A -0.6611
136 V A -0.7849
137 Q A -1.3127
138 P A -0.9403
139 A A -0.5961
140 D A -1.1765
141 L A 0.0000
142 A A -0.8920
143 A A -1.1617
144 L A 0.0000
145 A A 0.0000
146 E A -2.4825
147 K A -2.4691
148 L A 0.0000
149 N A -2.1430
150 L A 0.0000
151 S A -1.2075
152 Q A -1.5571
153 L A 0.0000
154 L A 0.0000
155 E A -1.8219
156 L A 0.0000
157 G A -1.3260
158 E A -1.7007
159 L A -0.9724
160 L A 0.0000
161 K A -2.2544
162 A A -0.9742
163 A A -0.7698
164 G A -1.1504
165 H A -0.9160
166 P A -0.7596
167 L A -0.6931
168 A A 0.0000
169 P A -1.0556
170 Q A -0.9882
171 V A 0.0000
172 E A -1.5807
173 A A -1.1359
174 L A -1.3672
175 L A 0.0000
176 K A -1.9127
177 E A -2.6649
178 K A -2.2861
179 L A 0.0000
180 K A -2.5505
181 A A -1.6044
182 A A -1.5950
183 S A -1.7264
184 A A 0.0000
185 A A -1.3052
186 E A -2.2494
187 A A 0.0000
188 A A 0.0000
189 G A -0.8241
190 V A 0.0000
191 I A 0.0000
192 F A -0.6103
193 Q A -0.6194
194 A A 0.0000
195 L A 0.0000
196 V A -0.5822
197 K A -1.9227
198 D A -2.7449
199 E A -3.5360
200 E A -3.6077
201 L A -2.6610
202 G A 0.0000
203 K A -3.4578
204 K A -2.8700
205 I A 0.0000
206 L A 0.0000
207 E A -3.4176
208 W A -2.8186
209 A A 0.0000
210 K A -3.7048
211 E A -3.4263
212 F A -2.6231
213 G A -2.6278
214 T A -2.9513
215 E A -3.7316
216 E A -4.0128
217 A A 0.0000
218 K A -4.5933
219 K A -3.8879
220 A A 0.0000
221 I A 0.0000
222 E A -3.2981
223 I A -1.5374
224 A A 0.0000
225 E A -2.9094
226 K A -2.7179
227 A A -1.2786
228 Y A -1.2558
229 E A -2.4027
230 L A -0.4374
231 Y A -0.1783
232 K A -1.4866
233 K A -1.7490
234 Y A -0.3145
235 L A -1.3410
236 E A -3.0699
237 H A -2.9615
238 H A -2.7161
239 H A -2.9158
240 H A -3.1359
241 H A -2.8708
242 H A -2.2754
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0086 1.7593 View CSV PDB
4.5 -1.0871 1.731 View CSV PDB
5.0 -1.1864 1.7006 View CSV PDB
5.5 -1.2815 1.6694 View CSV PDB
6.0 -1.3432 1.6381 View CSV PDB
6.5 -1.3545 1.6609 View CSV PDB
7.0 -1.3206 1.7316 View CSV PDB
7.5 -1.2581 1.8086 View CSV PDB
8.0 -1.1812 1.8878 View CSV PDB
8.5 -1.0963 1.9676 View CSV PDB
9.0 -1.0064 2.0465 View CSV PDB