Project name: e11048d69c31c02

Status: done

Started: 2026-07-22 16:58:38
Chain sequence(s) A: DIQMTQSPSSVSASVGDRVTITCRASQNINVWLAWYQQKPGKAPKLLIYKASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGQSYPWTFGGGTKVEIK
B: QVQLQESGPGLVRPSETLSLTCIVSGFSLTGYYWSWIRQPPGKGLEWIGYIYVDGSTNYNPSLKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARGGYGAMDYWGQGTLVTVSSSSA
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e11048d69c31c02/tmp/folded.pdb                (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-2.6675
Maximal score value
1.566
Average score
-0.544
Total score value
-122.9395

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -2.1763
2 I A 0.0000
3 Q A -2.1871
4 M A 0.0000
5 T A -1.3185
6 Q A -0.9193
7 S A -0.7424
8 P A -0.5742
9 S A -0.7381
10 S A -0.7597
11 V A -0.4447
12 S A -0.7902
13 A A -0.7025
14 S A -0.5662
15 V A 0.2835
16 G A -0.6883
17 D A -1.5544
18 R A -2.2552
19 V A 0.0000
20 T A -0.6222
21 I A 0.0000
22 T A -0.8486
23 C A 0.0000
24 R A -2.6675
25 A A 0.0000
26 S A -2.0640
27 Q A -2.5197
28 N A -2.3507
29 I A 0.0000
30 N A -1.4653
31 V A -0.3942
32 W A -0.0502
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.6161
40 P A -1.1638
41 G A -1.6736
42 K A -2.6248
43 A A -1.6699
44 P A 0.0000
45 K A -1.6527
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A -0.0391
50 K A -0.4686
51 A A 0.0000
52 S A -0.7261
53 N A -0.9667
54 L A -0.2680
55 Q A -0.5935
56 S A -0.5637
57 G A -0.5169
58 V A -0.3754
59 P A -0.3440
60 S A -0.4279
61 R A -0.6999
62 F A 0.0000
63 S A -0.4754
64 G A -0.5290
65 S A -0.7738
66 G A -1.0671
67 S A -1.1975
68 G A -1.5790
69 T A -1.9523
70 D A -2.0735
71 F A 0.0000
72 T A -0.7395
73 L A 0.0000
74 T A -0.6139
75 I A 0.0000
76 S A -1.3221
77 S A -1.0836
78 L A 0.0000
79 Q A -0.6579
80 P A -0.9478
81 E A -1.6383
82 D A 0.0000
83 F A -0.2908
84 A A 0.0000
85 T A -0.6562
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A 0.0427
92 Q A -0.6231
93 S A -0.2901
94 Y A 0.0752
95 P A 0.0000
96 W A 0.0000
97 T A -0.6243
98 F A -0.3020
99 G A 0.0000
100 G A -1.1281
101 G A -0.9286
102 T A 0.0000
103 K A -1.1987
104 V A 0.0000
105 E A -0.8743
106 I A -0.7144
107 K A -1.4603
1 Q B -1.3720
2 V B 0.0000
3 Q B -1.5776
4 L B 0.0000
5 Q B -1.2819
6 E B 0.0000
7 S B -0.5372
8 G B -0.4037
9 P B -0.0476
10 G B 0.5501
11 L B 0.9300
12 V B 0.0000
13 R B -1.5147
14 P B -1.2355
15 S B -1.4350
16 E B -2.0021
17 T B -1.5859
18 L B 0.0000
19 S B -0.9743
20 L B 0.0000
21 T B -0.3947
22 C B 0.0000
23 I B -0.5035
24 V B 0.0000
25 S B -0.8148
26 G B -0.5389
27 F B 0.7518
28 S B 0.1470
29 L B 0.0000
30 T B -0.0812
31 G B -0.3529
32 Y B 0.5481
33 Y B 0.7929
34 W B 0.0000
35 S B 0.0000
36 W B 0.0000
37 I B 0.0000
38 R B 0.0000
39 Q B -0.6103
40 P B -0.7325
41 P B -0.8393
42 G B -1.4835
43 K B -2.2615
44 G B -1.3801
45 L B 0.0000
46 E B -0.6814
47 W B 0.0000
48 I B 0.0000
49 G B 0.0000
50 Y B 0.0000
51 I B 0.0000
52 Y B -0.0641
53 V B -0.6138
54 D B -1.7386
55 G B -1.1129
56 S B -0.6914
57 T B -0.4158
58 N B -0.5784
59 Y B -0.5902
60 N B 0.0000
61 P B -1.1045
62 S B -0.9869
63 L B 0.0000
64 K B -2.0315
65 S B -1.3610
66 R B -1.5382
67 V B 0.0000
68 T B -0.9943
69 I B 0.0000
70 S B -0.5912
71 V B -0.8306
72 D B -1.6161
73 T B -1.5378
74 S B -1.4934
75 K B -2.2422
76 N B -1.2312
77 Q B -1.2094
78 F B 0.0000
79 S B -0.4656
80 L B 0.0000
81 K B -1.4330
82 L B 0.0000
83 N B -1.6951
84 S B -1.4669
85 V B 0.0000
86 T B -0.6287
87 A B -0.1744
88 A B 0.0554
89 D B 0.0000
90 T B 0.3822
91 A B 0.0000
92 V B 0.6313
93 Y B 0.0000
94 Y B 0.0000
95 C B 0.0000
96 A B 0.0000
97 R B 0.0000
98 G B 0.0000
99 G B 0.5278
100 Y B 1.1453
101 G B 0.5238
102 A B 0.0000
103 M B 0.0000
104 D B -0.4922
105 Y B -0.5332
106 W B -0.8663
107 G B 0.0000
108 Q B -1.9107
109 G B 0.0000
110 T B 0.2454
111 L B 1.5660
112 V B 0.0000
113 T B 0.5347
114 V B 0.0000
115 S B -0.4306
116 S B -0.6935
117 S B -0.5252
118 S B -0.4887
119 A B -0.1212
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6178 2.6092 View CSV PDB
4.5 -0.644 2.6092 View CSV PDB
5.0 -0.6724 2.6092 View CSV PDB
5.5 -0.6978 2.6092 View CSV PDB
6.0 -0.7131 2.6092 View CSV PDB
6.5 -0.7132 2.6092 View CSV PDB
7.0 -0.6991 2.6092 View CSV PDB
7.5 -0.6754 2.6092 View CSV PDB
8.0 -0.6451 2.6092 View CSV PDB
8.5 -0.6094 2.6092 View CSV PDB
9.0 -0.5693 2.6092 View CSV PDB