Project name: HSA6D10_prot3D_74_015M

Status: done

Started: 2026-02-25 09:13:48
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQTYDYHRDSWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e17aa547856d700/tmp/folded.pdb                (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:54)
Show buried residues

Minimal score value
-2.8184
Maximal score value
1.5356
Average score
-0.5432
Total score value
-124.9436

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7942
2 S A 0.3198
3 V A 1.4907
4 L A 0.0000
5 T A 0.0825
6 Q A 0.0000
7 P A -0.3895
8 P A -0.5758
9 S A -0.4370
11 V A -0.0201
12 S A -0.1330
13 G A 0.0000
14 A A -0.2066
15 P A -0.9352
16 G A -1.8225
17 Q A -2.5314
18 R A -2.6823
19 V A 0.0000
20 T A -0.5147
21 I A 0.0000
22 S A -0.2452
23 C A 0.0000
24 T A -0.2053
25 G A -0.0236
26 S A -0.2380
27 S A -0.5143
28 S A 0.0000
29 N A 0.0000
30 I A 0.0000
31 G A -0.8376
35 A A -0.1808
36 G A -0.5962
37 Y A -0.0107
38 D A -0.7159
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.3967
44 Q A 0.0000
45 L A -0.1366
46 P A -0.3954
47 G A -0.3855
48 T A -0.3760
49 A A -0.4673
50 P A 0.0000
51 K A -1.0719
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.1700
56 G A -1.2054
57 N A -1.0164
65 S A -1.2661
66 N A -1.9275
67 R A -2.0775
68 P A -1.3078
69 S A -0.8054
70 G A -0.9789
71 V A -0.8247
72 P A -1.3019
74 D A -2.2057
75 R A -1.5376
76 F A 0.0000
77 S A -0.9668
78 G A -0.7835
79 S A -0.6334
80 K A -1.0200
83 S A -0.8138
84 G A -0.9397
85 T A -0.7325
86 S A -0.6482
87 A A 0.0000
88 S A -0.4176
89 L A 0.0000
90 A A -0.5730
91 I A 0.0000
92 T A -1.9094
93 G A -1.8632
94 L A 0.0000
95 Q A -1.5447
96 A A -1.2226
97 E A -2.1813
98 D A 0.0000
99 E A -1.4810
100 A A 0.0000
101 D A -0.6549
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 T A 0.0000
107 Y A 0.0976
108 D A 0.0000
109 Y A 0.1565
110 H A -1.1772
113 R A -1.6026
114 D A -1.8540
115 S A 0.0000
116 W A 0.0670
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4342
121 G A 0.0000
122 T A 0.0000
123 K A -0.6952
124 V A 0.0000
125 T A -0.1256
126 V A 0.2728
127 L A 1.4782
1 Q B -0.8555
2 V B 0.2533
3 Q B -0.3863
4 L B 0.0000
5 V B 0.7085
6 Q B 0.0367
7 S B -0.6654
8 G B -0.8875
9 G B -0.5459
11 G B 0.4458
12 V B 1.5356
13 V B 0.1757
14 Q B -1.5484
15 P B -2.2525
16 G B -2.2074
17 R B -2.8184
18 S B -1.9603
19 L B -1.2366
20 R B -2.0753
21 L B 0.0000
22 S B -0.5307
23 C B 0.0000
24 A B -0.2073
25 A B -0.1639
26 S B -0.3343
27 G B -0.3259
28 F B 0.0165
29 T B -0.4251
30 F B -0.1982
35 S B 0.2784
36 S B 0.7331
37 Y B 1.2262
38 G B 0.6777
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7194
45 A B -0.9821
46 P B -0.9543
47 G B -1.4724
48 K B -2.2112
49 G B -1.4143
50 L B 0.0000
51 E B -0.5886
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.5228
58 Y B 0.7631
59 D B -1.2525
62 G B -0.6359
63 S B -0.7069
64 N B -0.5555
65 K B -0.8358
66 Y B -0.5670
67 Y B -0.8565
68 A B 0.0000
69 D B -1.5223
70 S B -1.3419
71 V B 0.0000
72 K B -2.1557
74 G B -1.5880
75 R B -1.5511
76 F B 0.0000
77 T B -0.8022
78 I B 0.0000
79 S B -0.7264
80 R B -1.2350
81 D B -1.5979
82 N B -1.5794
83 S B -1.5113
84 K B -2.2260
85 N B -1.4942
86 T B -0.9475
87 L B 0.0000
88 Y B -0.5387
89 L B 0.0000
90 Q B -1.1923
91 M B 0.0000
92 N B -2.1961
93 S B -2.0085
94 L B 0.0000
95 R B -2.7192
96 A B -1.5953
97 E B -1.7518
98 D B 0.0000
99 T B -0.2892
100 A B 0.0000
101 V B 0.1742
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4449
107 D B 0.0000
108 G B -0.6701
109 S B -0.7295
110 P B -1.2018
112 R B -1.9799
113 G B -1.5581
114 G B 0.0000
115 M B 0.0000
116 D B -1.1930
117 V B -0.5148
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9586
121 G B -0.4541
122 T B 0.0000
123 T B 0.0888
124 V B 0.0000
125 T B 0.3504
126 V B -0.6253
127 S B -0.4043
128 S B -0.4752
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5275 2.3634 View CSV PDB
4.5 -0.5575 2.3433 View CSV PDB
5.0 -0.5918 2.3174 View CSV PDB
5.5 -0.6247 2.2901 View CSV PDB
6.0 -0.65 2.2655 View CSV PDB
6.5 -0.6634 2.2478 View CSV PDB
7.0 -0.6665 2.2383 View CSV PDB
7.5 -0.6644 2.2345 View CSV PDB
8.0 -0.6598 2.2332 View CSV PDB
8.5 -0.6522 2.2327 View CSV PDB
9.0 -0.6399 2.2326 View CSV PDB