Project name: c3-mono

Status: done

Started: 2026-03-03 12:45:42
Chain sequence(s) A: GPQQQQMLALIDDELDAMDEDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKVPTAFPQDHQPRGRILLSHDELMHTDYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQDGWGDHCSTLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAVSLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEMCELRIQRALAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage A: GPQQQQMLALIDDELDAMDEDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKVPTAFPQDHQPRGRILLSHDELMHTDYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQDGWGDHCSTLKRLVKKPGQMSAWLRDDVCDLQKRPPETFS

QPMHRAMAYVCSFSRVAVSLRRRAL

QVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEMCELRIQRAL

APYRFMIAYCPFDEQSLLDLTVFAGTTTTT

A
(Red indicates removed residues)
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:17)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:17)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:50)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e20f86ca1644db3/tmp/folded.pdb                (00:06:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:39)
Show buried residues

Minimal score value
-4.2357
Maximal score value
2.3247
Average score
-1.118
Total score value
-319.7382

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
200 G A -1.7642
201 P A -1.9427
202 Q A -2.5097
203 Q A -2.3263
204 Q A -2.0349
205 Q A -1.5907
206 M A -0.2363
207 L A -0.3367
208 A A -0.7169
209 L A 0.0647
210 I A -0.4716
211 D A -2.4186
212 D A -3.0489
213 E A -2.7470
214 L A -2.3987
215 D A -3.2871
216 A A -2.4089
217 M A -2.7841
218 D A -3.6540
219 E A -4.1556
220 D A -4.1478
221 E A -3.4919
222 L A -2.6982
223 Q A -3.2202
224 Q A -2.7942
225 L A -1.1970
226 S A -1.5400
227 R A -2.7796
228 L A -1.3227
229 I A -0.6976
230 E A -3.1714
231 K A -3.6830
232 K A -3.5563
233 K A -4.2314
234 R A -4.2357
235 A A -3.6062
236 R A -4.0799
237 L A -2.0778
238 Q A -2.9124
239 R A -3.2637
240 G A -1.9984
241 A A -1.0572
242 A A -0.8977
243 S A -1.1410
244 S A -0.8825
245 G A -0.8243
246 T A -0.6052
247 S A -0.6688
248 P A -0.6293
249 S A -0.5631
250 S A -0.5252
251 T A -0.3785
252 S A -0.4015
253 P A -0.1430
254 V A 0.3691
255 Y A -0.0615
256 D A -1.0628
257 L A 0.0000
258 Q A -2.2236
259 R A -2.4527
260 Y A -1.7073
261 T A -1.5941
262 A A -1.7463
263 E A -2.5259
264 S A -1.8612
265 L A -1.6695
266 R A -2.6453
267 L A 0.0000
268 A A -0.9889
269 P A -0.6395
270 Y A -0.1495
271 P A -0.4918
272 A A -0.7510
273 D A -1.8541
274 L A 0.0000
275 K A -0.2160
276 V A 0.5891
277 P A 0.0000
278 T A 0.0576
279 A A 0.0000
280 F A 0.0308
281 P A -0.9457
282 Q A -2.3623
283 D A -3.1880
284 H A -2.6298
285 Q A -2.0277
286 P A -1.7322
287 R A -2.4498
288 G A -1.2157
289 R A -0.0088
290 I A 2.0902
291 L A 2.3247
292 L A 0.9051
293 S A -0.5148
294 H A -1.5623
295 D A -2.4827
296 E A -1.2264
297 L A -0.8069
298 M A 0.0000
299 H A -1.7996
300 T A 0.0000
301 D A 0.0000
302 Y A 0.0000
303 L A 0.0000
304 L A 0.0000
305 H A -0.5045
306 I A 0.0000
307 R A 0.0000
308 Q A -0.6825
309 Q A -0.1682
310 F A 0.0000
311 D A -0.8775
312 W A 0.3160
313 L A -0.7343
314 E A -2.3761
315 E A -3.2303
316 P A -2.1944
317 L A -1.2883
318 L A 0.0000
319 R A -3.4787
320 K A -2.6954
321 L A 0.0000
322 V A 0.0000
323 V A -0.5120
324 E A -0.9909
325 K A -0.2392
326 I A 0.9302
327 F A 1.8498
328 A A 0.7451
329 V A 0.0000
330 Y A 1.3493
331 N A -0.1391
332 A A 0.0000
333 P A -0.5935
334 N A -0.9573
335 L A 0.0000
336 H A -0.6608
337 T A -0.4594
338 L A 0.0000
339 L A 0.0000
340 A A -0.3282
341 I A -0.1456
342 I A 0.0000
343 D A 0.0000
344 E A -1.1957
345 T A 0.0000
346 L A -0.0382
347 S A 0.0000
348 Y A 0.0000
349 M A 0.3007
350 K A 0.0000
351 Y A 0.0000
352 H A 0.0000
353 H A -0.2693
354 L A 0.4375
355 H A -0.0333
356 G A -0.1517
357 L A 0.0000
358 P A 0.0000
359 V A 0.0000
360 N A 0.0000
361 P A -0.7370
362 H A -1.8774
363 D A 0.0000
364 P A 0.0000
365 Y A 0.0000
366 L A -0.3676
367 E A -1.3288
368 T A 0.0000
369 V A -0.2043
370 G A -1.0170
371 G A -0.8766
372 M A 0.0000
373 R A -2.3275
374 Q A -2.3361
375 L A -1.2357
376 L A -1.1366
377 F A 0.0000
378 N A -2.0351
379 K A -1.5231
380 L A -1.1908
381 N A -1.6824
382 N A -2.1774
383 L A 0.0000
384 D A -1.3301
385 L A 0.0000
386 G A 0.0000
387 C A -1.7772
388 I A -0.8222
389 L A -0.7576
390 D A -1.5977
391 H A -2.0238
392 Q A -2.3087
393 D A -2.5501
394 G A -1.2256
395 W A -0.5728
396 G A -1.4155
397 D A -2.0356
398 H A -1.7471
399 C A 0.0000
400 S A -1.0639
401 T A -0.9679
402 L A -0.8173
403 K A -1.4861
404 R A -1.4930
405 L A -1.2985
406 V A -1.5528
407 K A -2.5698
408 K A -2.6748
409 P A -2.3244
410 G A -1.8943
411 Q A -2.1245
412 M A 0.0000
413 S A -0.4918
414 A A -0.4980
415 W A 0.1616
416 L A -0.6724
417 R A -2.5138
418 D A -2.9393
419 D A -3.1692
420 V A 0.0000
421 C A -2.8939
422 D A -3.7319
423 L A -2.4640
424 Q A -2.6671
425 K A -3.2659
426 R A -2.7355
427 P A -1.9644
428 P A -1.7051
429 E A -2.2659
430 T A -1.1893
431 F A -0.8243
432 S A -0.9374
433 Q A -1.1934
459 V A 1.5784
460 T A 0.6393
461 G A 0.0543
462 T A 0.2823
463 P A 0.1985
464 Q A 0.0144
465 F A -0.2497
466 F A -0.2889
467 D A -1.8340
468 Q A -1.0818
469 F A 0.5860
470 D A -0.7075
471 T A -0.9981
472 N A -1.8661
473 N A -2.1017
474 A A -1.7712
475 M A -0.5942
476 G A -1.0504
477 T A -1.2295
478 Y A -1.0991
479 R A -2.0053
480 C A 0.0000
481 G A -0.9849
482 A A -0.5908
483 V A 0.0625
484 S A -0.3485
485 D A -1.1447
486 L A 0.6160
487 I A 0.0000
488 L A -0.1802
489 G A -0.3416
490 A A -0.2949
491 L A 0.0000
492 Q A -1.4589
493 C A -0.3581
494 H A -1.2543
495 E A -2.4976
496 C A -2.1357
497 Q A -2.4206
498 N A -2.4627
499 E A -2.3969
500 M A -0.9435
501 C A 0.0000
502 E A -3.0189
503 L A -0.9969
504 R A -1.9971
505 I A -1.6614
506 Q A -2.1296
507 R A -2.5431
508 A A 0.0000
509 L A -0.9574
510 A A -0.8946
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6807 4.8266 View CSV PDB
4.5 -0.7873 4.7621 View CSV PDB
5.0 -0.9164 4.6633 View CSV PDB
5.5 -1.0477 4.5481 View CSV PDB
6.0 -1.163 4.4368 View CSV PDB
6.5 -1.2522 4.3474 View CSV PDB
7.0 -1.3156 4.295 View CSV PDB
7.5 -1.3613 4.2781 View CSV PDB
8.0 -1.3953 4.2815 View CSV PDB
8.5 -1.4163 4.2928 View CSV PDB
9.0 -1.4193 4.3056 View CSV PDB