Project name: e3849a9058c7c93

Status: done

Started: 2026-04-14 19:24:01
Chain sequence(s) A: AKVAAWTLKAAACEAAAKVARAGGNSDATAGPGPGQADWDTGHRIDTAGPREGPGPGERVNGRIPLPVDWRWPWGGPGPGDDYEGIGGHESFRGPGPGLAAGSIKPIRGDILELRWHEANGPGPGSIKPIRGDILELRWHGPGPGRNTIERISRRFGIRVGPGPGELRWHEANNHFRVLFGPGPGRGDILELRWHEANNHGPGPGATAEIAAALAARQADAAYIPLPVDWRWAAYLPVDWRWPWAAYMADRIVARAAYLVLEVPTLRAAYSVDGRPVFK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:31)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e3849a9058c7c93/tmp/folded.pdb                (00:03:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:41)
Show buried residues

Minimal score value
-3.2411
Maximal score value
3.1459
Average score
-0.7017
Total score value
-195.7861

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A A -0.0331
2 K A -0.4995
3 V A 1.4230
4 A A 0.9193
5 A A 0.7060
6 W A 1.2982
7 T A 1.0838
8 L A 1.3051
9 K A -0.3531
10 A A -0.1383
11 A A -0.1123
12 A A -0.3229
13 C A -0.5212
14 E A -1.6412
15 A A -0.8355
16 A A -0.3892
17 A A -1.0860
18 K A -1.8326
19 V A 0.0232
20 A A -0.9210
21 R A -2.2386
22 A A -1.2885
23 G A -1.4407
24 G A -1.8445
25 N A -2.4069
26 S A -1.9266
27 D A -2.2404
28 A A -1.0756
29 T A -0.6337
30 A A -0.4776
31 G A -0.7070
32 P A -0.8047
33 G A -0.9127
34 P A -1.0589
35 G A -1.4873
36 Q A -1.7551
37 A A -1.4659
38 D A -1.9646
39 W A -0.6883
40 D A -2.0835
41 T A -1.3691
42 G A -1.6485
43 H A -2.0275
44 R A -2.1186
45 I A -0.0771
46 D A -1.4575
47 T A -0.7956
48 A A -0.7739
49 G A -1.4369
50 P A -1.9449
51 R A -3.1154
52 E A -3.1901
53 G A -2.1326
54 P A -1.7611
55 G A -1.5569
56 P A -1.5435
57 G A -1.9185
58 E A -2.9173
59 R A -2.5356
60 V A -0.6217
61 N A -1.6038
62 G A -1.6715
63 R A -1.2822
64 I A 1.0117
65 P A 0.8145
66 L A 1.8287
67 P A 1.1902
68 V A 1.2243
69 D A -0.6019
70 W A 0.0761
71 R A -0.9252
72 W A 0.4465
73 P A 0.3738
74 W A 0.8470
75 G A -0.0516
76 G A -0.7068
77 P A -0.9187
78 G A -1.3135
79 P A -1.5537
80 G A -1.9246
81 D A -2.9128
82 D A -2.7261
83 Y A -0.8853
84 E A -1.9048
85 G A -0.2917
86 I A 0.8041
87 G A -0.5985
88 G A -1.2632
89 H A -1.7498
90 E A -2.3485
91 S A -0.9576
92 F A 0.2806
93 R A -1.4442
94 G A -0.8570
95 P A -0.6611
96 G A -0.8467
97 P A -0.6159
98 G A -0.4552
99 L A 0.4029
100 A A -0.2934
101 A A -0.3136
102 G A -0.6518
103 S A -0.2116
104 I A 0.9387
105 K A -0.3648
106 P A -0.6330
107 I A -0.9301
108 R A -2.3802
109 G A -1.9049
110 D A -2.2741
111 I A -0.9515
112 L A 0.3143
113 E A 0.0000
114 L A -0.2691
115 R A -1.5327
116 W A 0.0000
117 H A -1.4824
118 E A -1.5754
119 A A -1.1392
120 N A -1.8159
121 G A -1.6927
122 P A -1.3976
123 G A -1.3798
124 P A -1.5272
125 G A 0.0000
126 S A -1.7721
127 I A 0.0000
128 K A -1.3997
129 P A -0.6396
130 I A -0.0955
131 R A -1.9944
132 G A -1.6648
133 D A -1.8246
134 I A -0.5119
135 L A -0.4390
136 E A -1.0482
137 L A -1.2332
138 R A -2.4630
139 W A -1.6323
140 H A -1.8300
141 G A -1.4736
142 P A -1.0337
143 G A -1.4362
144 P A -1.4161
145 G A -1.9928
146 R A -3.0779
147 N A -2.8788
148 T A -2.1528
149 I A 0.0000
150 E A -3.2137
151 R A -2.6440
152 I A 0.0000
153 S A 0.0000
154 R A -3.2411
155 R A -2.7386
156 F A -1.2374
157 G A -1.6579
158 I A -1.0927
159 R A -1.6275
160 V A -0.3138
161 G A -0.3145
162 P A -0.6085
163 G A -0.5616
164 P A -0.5682
165 G A -0.3367
166 E A 0.0000
167 L A 0.0000
168 R A -1.8403
169 W A -2.2175
170 H A -2.8795
171 E A -3.0775
172 A A -1.8822
173 N A -2.1603
174 N A -2.5563
175 H A -2.0535
176 F A -1.5344
177 R A -0.9211
178 V A 0.0894
179 L A 0.5419
180 F A 0.8056
181 G A -0.6833
182 P A -1.3279
183 G A -1.4157
184 P A -1.4375
185 G A -2.0192
186 R A -2.8543
187 G A -1.9193
188 D A -1.6200
189 I A 0.7334
190 L A 0.1290
191 E A -1.5478
192 L A -1.1466
193 R A -2.2929
194 W A -1.5212
195 H A -2.2072
196 E A -3.0748
197 A A -2.0763
198 N A -3.0107
199 N A -2.7645
200 H A -2.5109
201 G A -1.6994
202 P A -1.2678
203 G A -0.9588
204 P A -0.7422
205 G A -0.8567
206 A A -0.5298
207 T A -0.2207
208 A A -0.3685
209 E A -0.6631
210 I A 1.5405
211 A A 1.0459
212 A A 0.3930
213 A A 0.4591
214 L A 0.9929
215 A A 0.0038
216 A A -1.0053
217 R A -2.3282
218 Q A -2.1396
219 A A -1.5876
220 D A -2.1215
221 A A -0.8911
222 A A 0.2735
223 Y A 2.1430
224 I A 2.6864
225 P A 1.9430
226 L A 2.2097
227 P A 1.1971
228 V A 1.3778
229 D A -0.5073
230 W A 0.2582
231 R A -0.7245
232 W A 1.0087
233 A A 0.9675
234 A A 0.9542
235 Y A 1.6625
236 L A 1.4381
237 P A 0.5835
238 V A 0.6366
239 D A -0.4498
240 W A 0.3383
241 R A -0.9048
242 W A 0.7220
243 P A 0.6776
244 W A 1.2245
245 A A 0.5934
246 A A 0.5112
247 Y A 0.8187
248 M A 0.4792
249 A A 0.0556
250 D A -1.3608
251 R A -1.6639
252 I A 0.2554
253 V A 0.7889
254 A A -0.2423
255 R A -0.4669
256 A A 1.0144
257 A A 1.5930
258 Y A 2.5017
259 L A 2.4905
260 V A 3.1459
261 L A 2.6510
262 E A 1.0239
263 V A 2.1172
264 P A 0.6912
265 T A 0.3443
266 L A 0.8858
267 R A -0.8171
268 A A -0.0968
269 A A 0.6294
270 Y A 1.0885
271 S A 0.4563
272 V A 0.7182
273 D A -1.6394
274 G A -1.3850
275 R A -1.7030
276 P A -0.1710
277 V A 1.7747
278 F A 1.7041
279 K A -0.3131
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.2526 5.3764 View CSV PDB
4.5 0.1632 5.33 View CSV PDB
5.0 0.0597 5.2778 View CSV PDB
5.5 -0.0401 5.2235 View CSV PDB
6.0 -0.1212 5.1685 View CSV PDB
6.5 -0.1779 5.1184 View CSV PDB
7.0 -0.2166 5.1183 View CSV PDB
7.5 -0.2463 5.1183 View CSV PDB
8.0 -0.2701 5.1181 View CSV PDB
8.5 -0.2852 5.1176 View CSV PDB
9.0 -0.2881 5.1577 View CSV PDB