Project name: e3b5c1dc0e4fa92

Status: done

Started: 2025-02-21 07:01:20
Chain sequence(s) A: MASNQQSYKAGETKRKTQEKTGQAMGAMRDKAEEGKDKTSQTAQKAQQKAQETAQAAKDKTSQAAQTTQQKAQETAQAAKDKTSQAAQTTQQKAHETTQSSKEKTSQAAQTAQEKARETKDKTGSYLSETGEAVKQKAQDAAQYTKETAQNAAQYTKETAEAGKDKTGGFLSQTGEHVKQMAMGAADAVKHTFGMATEEEDREHYPGTTTCTTQSTDPTRHTYERK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-5.606
Maximal score value
1.4125
Average score
-2.5415
Total score value
-574.3898

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5486
2 A A -0.4847
3 S A -1.0904
4 N A -2.0173
5 Q A -2.3382
6 Q A -2.4877
7 S A -1.7429
8 Y A -1.3643
9 K A -3.0067
10 A A -2.2385
11 G A -2.7764
12 E A -3.6978
13 T A -3.4518
14 K A -4.5756
15 R A -5.4898
16 K A -5.1175
17 T A -4.2545
18 Q A -4.7661
19 E A -4.9412
20 K A -4.2836
21 T A -2.6182
22 G A -2.2782
23 Q A -2.3975
24 A A -1.0425
25 M A -0.5269
26 G A -1.4017
27 A A -1.3304
28 M A -1.1608
29 R A -3.2629
30 D A -4.2144
31 K A -4.2071
32 A A -3.7396
33 E A -5.1438
34 E A -5.3918
35 G A -4.4394
36 K A -4.9369
37 D A -5.0749
38 K A -4.4485
39 T A -3.3272
40 S A -3.1948
41 Q A -3.6171
42 T A -2.8417
43 A A -2.6135
44 Q A -3.6313
45 K A -3.9759
46 A A -3.0104
47 Q A -3.9367
48 Q A -4.3865
49 K A -4.3775
50 A A -3.2450
51 Q A -3.8391
52 E A -4.0506
53 T A -2.8057
54 A A -2.5792
55 Q A -3.6446
56 A A -2.8278
57 A A -2.6868
58 K A -3.9019
59 D A -4.1114
60 K A -3.8115
61 T A -2.7542
62 S A -2.7156
63 Q A -3.1370
64 A A -2.1707
65 A A -2.1032
66 Q A -2.8589
67 T A -2.3542
68 T A -2.5297
69 Q A -3.4717
70 Q A -3.8692
71 K A -3.9966
72 A A -3.0638
73 Q A -3.7132
74 E A -4.1093
75 T A -2.8049
76 A A -2.7337
77 Q A -3.5655
78 A A -2.6933
79 A A -2.6928
80 K A -3.6438
81 D A -3.5332
82 K A -3.5469
83 T A -2.5952
84 S A -2.6664
85 Q A -3.0340
86 A A -2.1597
87 A A -2.2904
88 Q A -3.0396
89 T A -2.4072
90 T A -2.5646
91 Q A -3.4848
92 Q A -3.8524
93 K A -3.9826
94 A A -3.0787
95 H A -3.9463
96 E A -4.1590
97 T A -3.0164
98 T A -3.2050
99 Q A -3.9342
100 S A -3.1932
101 S A -3.1933
102 K A -4.2167
103 E A -4.2952
104 K A -3.9420
105 T A -2.8385
106 S A -3.0341
107 Q A -3.1659
108 A A -2.2484
109 A A -2.3866
110 Q A -3.0433
111 T A -2.6198
112 A A -2.4967
113 Q A -3.9731
114 E A -4.9095
115 K A -4.7867
116 A A -3.8390
117 R A -5.6060
118 E A -5.5886
119 T A -4.1652
120 K A -4.5711
121 D A -4.8555
122 K A -3.9780
123 T A -2.1459
124 G A -1.3329
125 S A -0.1595
126 Y A 1.2389
127 L A 0.7362
128 S A -0.8341
129 E A -1.7216
130 T A -0.9756
131 G A -1.9735
132 E A -3.0751
133 A A -2.0715
134 V A -1.4109
135 K A -3.3925
136 Q A -3.7148
137 K A -3.5321
138 A A -2.5891
139 Q A -3.3246
140 D A -3.5600
141 A A -2.3299
142 A A -2.2186
143 Q A -2.9852
144 Y A -1.2661
145 T A -1.9030
146 K A -3.3384
147 E A -3.4425
148 T A -2.2188
149 A A -2.0987
150 Q A -3.0697
151 N A -2.8642
152 A A -1.7341
153 A A -1.8749
154 Q A -2.7096
155 Y A -1.1682
156 T A -1.7533
157 K A -3.3109
158 E A -3.4437
159 T A -2.3561
160 A A -2.6966
161 E A -4.2206
162 A A -3.5566
163 G A -3.2229
164 K A -4.0793
165 D A -4.1305
166 K A -2.9959
167 T A -1.5392
168 G A -1.2688
169 G A -0.4079
170 F A 1.1696
171 L A 1.0872
172 S A -0.5987
173 Q A -1.2492
174 T A -0.6528
175 G A -1.1090
176 E A -2.7077
177 H A -1.8475
178 V A -0.1118
179 K A -2.0642
180 Q A -1.5701
181 M A 0.0471
182 A A -0.0950
183 M A 0.2302
184 G A -0.3997
185 A A -0.2828
186 A A -0.4539
187 D A -1.5983
188 A A -0.5183
189 V A 0.7276
190 K A -1.2103
191 H A -1.1057
192 T A 0.2380
193 F A 1.4125
194 G A 0.4836
195 M A 0.7708
196 A A -0.3874
197 T A -1.3237
198 E A -3.2889
199 E A -4.3726
200 E A -4.4352
201 D A -4.8282
202 R A -4.4408
203 E A -3.3873
204 H A -1.7800
205 Y A 0.1971
206 P A -0.0670
207 G A -0.3906
208 T A -0.3273
209 T A -0.0666
210 T A 0.2084
211 C A 0.4676
212 T A -0.1198
213 T A -0.5842
214 Q A -1.4805
215 S A -1.3245
216 T A -1.4159
217 D A -2.3352
218 P A -1.5968
219 T A -1.7085
220 R A -2.6629
221 H A -1.7458
222 T A -0.6624
223 Y A -0.2120
224 E A -2.5093
225 R A -3.3296
226 K A -2.9963
Download PDB file
View in 3Dmol