Project name: AAVA_R1

Status: done

Started: 2026-08-21 04:27:40
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e3f68bcf00d70df/tmp/folded.pdb                (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:52)
Show buried residues

Minimal score value
-2.7142
Maximal score value
1.9656
Average score
-0.5358
Total score value
-132.8689

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6090
2 V A -1.3112
3 Q A -1.9774
4 L A 0.0000
5 Q A -1.8548
6 E A 0.0000
7 S A -0.7003
8 G A -0.4287
9 P A -0.0644
10 G A 0.2306
11 L A 0.6982
12 V A 0.0000
13 K A -1.7118
14 P A -1.2938
15 S A -1.3852
16 Q A -1.8888
17 T A -1.5245
18 L A 0.0000
19 S A -0.8801
20 L A 0.0000
21 T A -0.5924
22 A A 0.0000
23 T A -1.2449
24 V A 0.0000
25 S A -1.3329
26 G A -1.3390
27 G A -1.0352
28 S A -0.6465
29 I A 0.0000
30 S A -0.2885
31 S A -0.3436
32 G A -0.1775
33 D A -0.0873
34 Y A 0.5606
35 Y A 0.5745
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6907
43 P A -0.6587
44 G A -1.1246
45 C A -1.2072
46 K A -2.0213
47 G A -1.2181
48 L A 0.0000
49 E A -0.7391
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1311
54 I A 0.0000
55 Y A 0.2952
56 Y A 0.2783
57 S A -0.1078
58 G A -0.2548
59 S A -0.2637
60 T A -0.2482
61 D A -0.6892
62 Y A -0.6961
63 N A -0.9033
64 P A -1.2361
65 S A -1.1536
66 L A 0.0000
67 K A -2.0810
68 S A -1.4063
69 R A -1.6077
70 V A 0.0000
71 T A -1.0107
72 M A 0.0000
73 S A -0.3557
74 V A -0.3726
75 D A -1.2180
76 T A -1.0293
77 S A -1.3477
78 K A -2.1773
79 N A -1.4549
80 Q A -1.2734
81 F A 0.0000
82 S A -0.4902
83 L A 0.0000
84 K A -1.3725
85 V A 0.0000
86 N A -1.6942
87 S A -1.4889
88 V A 0.0000
89 T A -0.7074
90 A A -0.3360
91 A A -0.0491
92 D A 0.0000
93 T A 0.2356
94 A A 0.0000
95 V A 0.2438
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7376
103 I A 1.4682
104 F A 1.9656
105 G A 0.9034
106 V A 0.8197
107 G A 0.7641
108 T A 0.0000
109 F A 0.0000
110 D A -0.4880
111 Y A -0.5515
112 W A -0.7929
113 G A 0.0000
114 Q A -1.6346
115 G A -0.7430
116 T A -0.1772
117 L A 0.8213
118 V A 0.0000
119 T A 0.2737
120 V A 0.0000
121 S A -0.3599
122 S A -0.6624
123 A A -0.5917
124 A A -0.3557
125 G A -0.8378
126 G A -1.0814
127 G A -1.1436
128 G A -1.1742
129 S A -1.0284
130 G A -1.1632
131 G A -1.2018
132 G A -1.2042
133 G A -1.2154
134 S A -1.0481
135 G A -1.1902
136 G A -1.2071
137 G A -1.2056
138 G A -1.1486
139 S A -0.8428
140 D A -0.7564
141 I A -0.0835
142 V A 1.0067
143 M A 0.0000
144 T A -0.5754
145 Q A -0.7661
146 S A -0.7456
147 P A -0.3790
148 A A -0.3547
149 T A -0.4544
150 L A -0.2048
151 S A -0.3584
152 L A -0.6702
153 S A -0.9698
154 P A -1.5002
155 G A -1.8156
156 E A -2.3854
157 R A -2.7142
158 A A 0.0000
159 T A -0.6381
160 L A 0.0000
161 S A -0.8798
162 V A 0.0000
163 R A -2.3212
164 A A 0.0000
165 S A -0.8487
166 Q A -1.5655
167 S A -1.2349
168 V A 0.0000
169 S A -0.4965
170 S A -0.1763
171 Y A 0.6715
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3858
179 P A -0.9306
180 G A -0.9520
181 C A -1.0974
182 Q A -1.4925
183 A A -1.1247
184 P A 0.0000
185 R A -1.2983
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2689
190 D A -0.3725
191 A A 0.0000
192 S A -0.8751
193 N A -1.3020
194 R A -1.4490
195 A A -0.8902
196 T A -0.5678
197 G A -0.5682
198 I A -0.5070
199 P A -0.3620
200 A A -0.3714
201 R A -0.7362
202 F A 0.0000
203 S A -0.6775
204 G A 0.0000
205 S A -0.7514
206 G A -1.0620
207 S A -0.9117
208 G A -1.0543
209 T A -1.7359
210 D A -2.1356
211 F A 0.0000
212 T A -0.7422
213 L A 0.0000
214 T A -0.6155
215 I A 0.0000
216 S A -1.4851
217 S A -1.7995
218 L A 0.0000
219 E A -2.2453
220 P A -1.4673
221 E A -2.2966
222 D A 0.0000
223 F A -0.7120
224 A A 0.0000
225 V A -0.6095
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1193
233 S A -0.2787
234 T A -0.4079
235 P A -0.4271
236 L A 0.0000
237 T A 0.1408
238 F A 0.2463
239 G A 0.0000
240 G A -0.8033
241 G A -0.7687
242 T A 0.0000
243 K A -0.8685
244 A A 0.0000
245 E A -0.4882
246 I A 0.6826
247 K A -0.9022
248 A A -0.3542
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4966 4.8965 View CSV PDB
4.5 -0.5176 4.8883 View CSV PDB
5.0 -0.5417 4.8691 View CSV PDB
5.5 -0.5634 4.8355 View CSV PDB
6.0 -0.5764 4.7909 View CSV PDB
6.5 -0.576 4.7411 View CSV PDB
7.0 -0.5629 4.6893 View CSV PDB
7.5 -0.5416 4.6368 View CSV PDB
8.0 -0.5159 4.5842 View CSV PDB
8.5 -0.4869 4.5319 View CSV PDB
9.0 -0.4552 4.4804 View CSV PDB