Project name: e479e98ca6139e6

Status: done

Started: 2026-07-26 11:58:57
Chain sequence(s) A: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPAETLVDAFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMAIMRAKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKMGGGGSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGGGGSSSNAKFNAFRSDFQAFKDDFARFNQRFDNFATKYR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e479e98ca6139e6/tmp/folded.pdb                (00:03:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:51)
Show buried residues

Minimal score value
-4.4654
Maximal score value
3.068
Average score
-1.0198
Total score value
-270.2594

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.2559
2 N A 1.0659
3 F A 2.9865
4 L A 3.0680
5 L A 2.4952
6 S A 2.0711
7 W A 2.8563
8 V A 2.5028
9 H A 1.1878
10 W A 2.1657
11 S A 2.0164
12 L A 2.4913
13 A A 2.2575
14 L A 2.4301
15 L A 2.6084
16 L A 2.4849
17 Y A 2.1097
18 L A 1.3606
19 H A 0.0413
20 H A -0.3718
21 A A -0.4499
22 K A -1.6094
23 W A -0.4306
24 S A -0.8841
25 Q A -1.3081
26 A A -0.2592
27 A A -0.1217
28 P A -0.1442
29 M A 0.3760
30 A A -0.5902
31 E A -1.9658
32 G A -1.7396
33 G A -1.9777
34 G A -2.1933
35 Q A -3.0091
36 N A -3.1106
37 H A -3.0173
38 H A -2.1768
39 E A -1.8658
40 V A 1.1130
41 V A 1.8226
42 K A 0.6747
43 F A 2.3352
44 M A 1.1187
45 D A -0.2580
46 V A 1.0528
47 Y A 0.3509
48 Q A -1.1609
49 R A -1.9815
50 S A -0.9040
51 Y A -0.6146
52 C A 0.0000
53 H A -1.5144
54 P A -1.2893
55 A A -1.4145
56 E A -1.5957
57 T A -0.3057
58 L A 0.9531
59 V A 0.0440
60 D A -0.6914
61 A A 0.0000
62 F A 0.0018
63 Q A -1.5692
64 E A -1.1964
65 Y A -0.6020
66 P A -0.8445
67 D A -1.7031
68 E A -0.6485
69 I A 0.7551
70 E A -1.0992
71 Y A -0.3206
72 I A 0.3318
73 F A 0.0000
74 K A -1.4140
75 P A -1.2274
76 S A -0.6245
77 C A -0.2833
78 V A 0.0000
79 P A -0.1428
80 L A 0.0000
81 M A -0.9238
82 R A -1.0486
83 C A -0.9451
84 G A -0.8011
85 G A -0.7971
86 C A -0.8081
87 C A -1.6635
88 N A -2.2762
89 D A -3.3491
90 E A -3.1006
91 G A -2.7890
92 L A -2.4042
93 E A -2.0464
94 C A -0.6330
95 V A -1.0130
96 P A -1.8339
97 T A -2.0089
98 E A -3.0024
99 E A -3.0405
100 S A -1.8157
101 N A -1.2804
102 I A -0.2146
103 T A -0.4215
104 M A -0.2141
105 A A -0.3522
106 I A 0.0000
107 M A -0.4176
108 R A -1.1525
109 A A 0.0000
110 K A -1.7630
111 P A -1.6557
112 H A -2.0147
113 Q A -2.3882
114 G A -2.2186
115 Q A -2.0342
116 H A -1.1408
117 I A 0.6429
118 G A -0.4346
119 E A -1.4769
120 M A 0.0000
121 S A -0.6643
122 F A 0.0000
123 L A -0.5669
124 Q A -1.4594
125 H A -2.2354
126 N A -2.3407
127 K A -2.9497
128 C A -2.0728
129 E A -1.7570
130 C A 0.0000
131 R A -2.6989
132 P A -2.7885
133 K A -3.4855
134 K A -3.9455
135 D A -4.4654
136 R A -4.1081
137 A A -3.7437
138 R A -4.0657
139 Q A -3.7769
140 E A -3.4494
141 N A -2.6266
142 P A -1.5512
143 C A 0.0000
144 G A -0.9540
145 P A -0.7243
146 C A -1.2667
147 S A -1.4078
148 E A -2.3142
149 R A -2.9855
150 R A -2.6611
151 K A -2.6878
152 H A -1.9786
153 L A -1.6356
154 F A -1.1795
155 V A 0.4017
156 Q A -0.6973
157 D A -1.2483
158 P A -1.6331
159 Q A -1.8081
160 T A -1.3271
161 C A -1.1395
162 K A -1.6653
163 C A -0.7782
164 S A -0.7605
165 C A -1.8789
166 K A -2.2267
167 N A -2.6664
168 T A -2.5675
169 D A -3.2334
170 S A -2.3605
171 R A -3.1877
172 C A -2.8547
173 K A -2.6707
174 M A -1.2733
175 G A -1.3186
176 G A -1.2633
177 G A -1.1056
178 G A -1.3586
179 S A -1.0178
180 L A -0.7144
181 A A -0.5796
182 E A -1.1256
183 A A 0.0000
184 K A -0.8632
185 V A 0.2123
186 L A 0.3772
187 A A 0.0000
188 N A -2.0672
189 R A -2.5720
190 E A -2.3058
191 L A 0.0000
192 D A -3.4659
193 K A -2.7854
194 Y A -0.6320
195 G A -1.2583
196 V A -0.7421
197 S A -0.9074
198 D A -1.8087
199 Y A 0.0573
200 Y A -0.2346
201 K A -1.7699
202 N A -1.9097
203 L A -0.7572
204 I A 0.0000
205 N A -1.9509
206 N A -2.4013
207 A A 0.0000
208 K A -2.2906
209 T A -1.5678
210 V A -1.4894
211 E A -2.3241
212 G A -1.6764
213 V A 0.0000
214 K A -2.6808
215 A A -2.0273
216 L A -1.3206
217 I A -1.8030
218 D A -2.6802
219 E A -2.4831
220 I A 0.0000
221 L A -0.4571
222 A A -0.7460
223 A A -0.4245
224 L A 0.2296
225 P A -0.3965
226 G A -0.8458
227 G A -0.9208
228 G A -1.1901
229 G A -1.0776
230 S A -0.9610
231 S A -0.9711
232 S A -1.2976
233 N A -1.5172
234 A A -1.3127
235 K A -1.5648
236 F A -0.2742
237 N A -1.6292
238 A A -1.1862
239 F A -0.3731
240 R A -1.6994
241 S A -1.6778
242 D A -1.5374
243 F A -0.5201
244 Q A -1.7193
245 A A -1.1837
246 F A -0.5540
247 K A -1.4789
248 D A -1.8582
249 D A -1.6360
250 F A -0.0352
251 A A -1.0393
252 R A -2.2694
253 F A -0.2657
254 N A -1.2071
255 Q A -2.3659
256 R A -1.6858
257 F A 0.0042
258 D A -1.9631
259 N A -1.2087
260 F A 0.4316
261 A A -0.3606
262 T A -1.0343
263 K A -1.1792
264 Y A -0.0375
265 R A -1.4464
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.484 6.0694 View CSV PDB
4.5 -0.5876 6.0694 View CSV PDB
5.0 -0.7069 6.0694 View CSV PDB
5.5 -0.817 6.0694 View CSV PDB
6.0 -0.8968 6.0694 View CSV PDB
6.5 -0.9348 6.0694 View CSV PDB
7.0 -0.9341 6.0694 View CSV PDB
7.5 -0.9083 6.0694 View CSV PDB
8.0 -0.8683 6.0694 View CSV PDB
8.5 -0.8155 6.0694 View CSV PDB
9.0 -0.7465 6.0694 View CSV PDB