Project name: e50f182fc1acb36

Status: done

Started: 2026-07-21 19:43:19
Chain sequence(s) A: MGFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDGGGGSEKPKVKKHITSALKKLVDKYRNDEHVRKVFDEIQQKLHCCGADSPKDYGENPPTSCSKDGVQFTEGCIKKVSDLSKAHLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:35)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:35)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:35)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e50f182fc1acb36/tmp/folded.pdb                (00:06:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:36)
Show buried residues

Minimal score value
-4.0194
Maximal score value
0.5805
Average score
-1.2464
Total score value
-284.1725

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.9948
2 G A -0.5674
3 F A 0.0000
4 D A -1.1775
5 A A 0.0000
6 S A -1.6674
7 N A -1.6051
8 F A 0.0000
9 K A -2.8536
10 D A -1.8575
11 F A 0.0000
12 S A 0.0000
13 S A -0.9309
14 I A -0.3401
15 A A -0.3507
16 S A -0.4568
17 A A 0.0000
18 S A 0.0000
19 S A -0.9540
20 S A -1.4403
21 W A -1.7894
22 Q A -2.3470
23 N A -2.2346
24 Q A -2.0412
25 S A -1.7132
26 G A -2.2179
27 S A 0.0000
28 T A -1.6045
29 M A 0.0000
30 I A -0.0315
31 I A 0.0000
32 Q A -0.4364
33 V A 0.0000
34 D A -0.3469
35 S A 0.0000
36 F A 0.0000
37 G A 0.0000
38 N A 0.0000
39 V A 0.0000
40 S A -0.3615
41 G A 0.0000
42 Q A -1.8995
43 Y A 0.0000
44 V A 0.0000
45 N A -2.5350
46 R A 0.0000
47 A A 0.0000
48 Q A -2.4764
49 G A -1.9553
50 T A -1.9828
51 G A 0.0000
52 C A -1.3458
53 Q A -2.3071
54 N A -2.2320
55 S A 0.0000
56 P A -0.7676
57 Y A -0.4203
58 P A -0.8774
59 L A 0.0000
60 T A 0.0000
61 G A 0.0000
62 R A -2.9435
63 V A 0.0000
64 N A -2.7040
65 G A -0.9209
66 T A -0.6399
67 F A 0.0000
68 I A 0.5805
69 A A 0.0000
70 F A 0.0000
71 S A 0.0000
72 V A 0.0000
73 G A 0.0000
74 W A 0.0760
75 N A 0.0000
76 N A -1.5038
77 S A 0.0000
78 T A -1.7819
79 E A -2.8972
80 N A -2.6673
81 C A 0.0000
82 N A -2.6521
83 S A -1.6819
84 A A 0.0000
85 T A -1.3865
86 G A -1.0873
87 W A 0.0000
88 T A -0.0392
89 G A 0.0000
90 Y A 0.3790
91 A A 0.0000
92 Q A -2.1910
93 V A 0.0000
94 N A -3.1773
95 G A -2.9580
96 N A -3.0494
97 N A -2.9750
98 T A -2.0809
99 E A -1.6989
100 I A 0.0000
101 V A 0.5067
102 T A 0.0000
103 S A 0.0000
104 W A 0.0000
105 N A 0.0000
106 L A 0.0000
107 A A -0.6887
108 Y A -0.2749
109 E A -1.2862
110 G A -0.9106
111 G A -1.1512
112 S A -0.8807
113 G A -0.9488
114 P A -1.2950
115 A A 0.0000
116 I A 0.0000
117 E A -1.5918
118 Q A -1.6846
119 G A 0.0000
120 Q A -1.3274
121 D A -0.9588
122 T A 0.0000
123 F A 0.3658
124 Q A 0.0000
125 Y A 0.3965
126 V A 0.0000
127 P A -0.7444
128 T A -1.2700
129 T A -1.4375
130 E A -2.4117
131 N A 0.0000
132 K A -2.9706
133 S A -3.3436
134 L A 0.0000
135 L A -2.7737
136 K A -3.4876
137 D A -4.0194
138 G A -3.0057
139 G A -2.8590
140 G A -2.2018
141 G A -2.9368
142 S A -2.2782
143 E A -3.7248
144 K A -3.6241
145 P A -2.8247
146 K A -3.5986
147 V A -2.3980
148 K A -2.2595
149 K A -3.4627
150 H A -2.5809
151 I A -1.4046
152 T A -1.8291
153 S A -2.2081
154 A A -1.3848
155 L A -1.4933
156 K A -3.0721
157 K A -3.1254
158 L A -1.5395
159 V A -1.9643
160 D A -3.3528
161 K A -3.0933
162 Y A 0.0000
163 R A -2.8341
164 N A -3.0465
165 D A -2.3546
166 E A -2.3224
167 H A -1.9565
168 V A 0.0000
169 R A -2.3339
170 K A -2.2244
171 V A 0.0000
172 F A -1.6370
173 D A -2.5017
174 E A -2.1036
175 I A 0.0000
176 Q A -1.8408
177 Q A -2.3091
178 K A -2.2172
179 L A 0.0000
180 H A -1.7541
181 C A -1.7944
182 C A 0.0000
183 G A 0.0000
184 A A -1.4042
185 D A -2.0419
186 S A -2.0627
187 P A 0.0000
188 K A -2.9535
189 D A -2.5482
190 Y A 0.0000
191 G A 0.0000
192 E A -2.3188
193 N A -2.3379
194 P A 0.0000
195 P A 0.0000
196 T A 0.0000
197 S A 0.0000
198 C A 0.0000
199 S A 0.0000
200 K A 0.0000
201 D A 0.0000
202 G A 0.0000
203 V A 0.0000
204 Q A -0.9090
205 F A 0.0000
206 T A -1.3951
207 E A -2.3029
208 G A -1.9746
209 C A 0.0000
210 I A 0.0000
211 K A -3.5095
212 K A -3.0131
213 V A 0.0000
214 S A -3.2053
215 D A -3.8093
216 L A -2.3578
217 S A 0.0000
218 K A -3.8498
219 A A -2.5983
220 H A 0.0000
221 L A -2.9380
222 E A -3.4192
223 H A -3.0300
224 H A 0.0000
225 H A -3.0495
226 H A -3.1878
227 H A -2.5628
228 H A -2.6328
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.3243 1.5843 View CSV PDB
4.5 -1.3794 1.5843 View CSV PDB
5.0 -1.4423 1.5843 View CSV PDB
5.5 -1.4926 1.5843 View CSV PDB
6.0 -1.51 1.5843 View CSV PDB
6.5 -1.4856 1.5842 View CSV PDB
7.0 -1.4296 1.5842 View CSV PDB
7.5 -1.3598 1.5842 View CSV PDB
8.0 -1.2857 1.5842 View CSV PDB
8.5 -1.2081 1.584 View CSV PDB
9.0 -1.1247 1.5835 View CSV PDB