Project name: e555a6013212166

Status: done

Started: 2026-07-15 05:55:59
Chain sequence(s) A: EVKLEESGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVRGRFTISRHDSKSSVYLQMNNLRAEDTGIYYCTGGFDFWGQGTTLTVSS
B: DIVMTQSHKFMSTSLGDRVSITCKASQDVGIDVAWHRQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTVFTFTISSVQAEDLAVYYCQHHYFPPYTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:04)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:04)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:04)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:04)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:05)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:05)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:15:51)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e555a6013212166/tmp/folded.pdb                (00:15:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:27:28)
Show buried residues

Minimal score value
-3.1108
Maximal score value
2.4514
Average score
-0.6188
Total score value
-137.3701

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8951
2 V A -0.8188
3 K A -1.9628
4 L A 0.0000
5 E A -1.4981
6 E A 0.0000
7 S A -0.8838
8 G A -0.9658
9 G A -0.4108
10 G A 0.3621
11 L A 1.2371
12 V A 0.0000
13 Q A -1.3851
14 P A -2.1425
15 G A -2.5749
16 R A -2.9076
17 P A -2.3210
18 M A -1.4969
19 K A -1.9370
20 L A 0.0000
21 S A -0.4582
22 C A 0.0000
23 V A 0.1920
24 A A 0.0000
25 S A -0.9971
26 G A -1.0803
27 F A -0.5076
28 T A -0.4899
29 F A 0.0000
30 S A -1.6757
31 D A -2.0125
32 Y A -0.7721
33 W A -0.3361
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.7808
40 S A -1.5311
41 P A -1.6581
42 E A -3.0594
43 K A -3.1108
44 G A -1.7888
45 L A 0.0000
46 E A -0.7257
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 Q A 0.0000
51 I A 0.0000
52 R A -1.0126
53 N A 0.0000
54 K A -2.3861
55 P A -1.3826
56 Y A -0.6587
57 N A -1.8361
58 Y A -1.2833
59 E A -1.6337
60 T A -0.5225
61 Y A -0.1912
62 Y A -0.8029
63 S A -1.5844
64 D A -2.6569
65 S A -1.7474
66 V A 0.0000
67 R A -2.6006
68 G A -1.8298
69 R A 0.0000
70 F A 0.0000
71 T A -0.7028
72 I A 0.0000
73 S A -0.4553
74 R A -0.7102
75 H A -1.4420
76 D A -1.9750
77 S A -1.5083
78 K A -2.0065
79 S A -0.9872
80 S A 0.0000
81 V A 0.0000
82 Y A -0.1790
83 L A 0.0000
84 Q A -1.0382
85 M A 0.0000
86 N A -2.3304
87 N A -2.8446
88 L A 0.0000
89 R A -3.0822
90 A A -1.8442
91 E A -2.8034
92 D A 0.0000
93 T A -0.8897
94 G A 0.0000
95 I A 0.2222
96 Y A 0.0000
97 Y A 0.0000
98 C A 0.0000
99 T A 0.0000
100 G A 0.0000
101 G A -0.2919
102 F A 0.0000
103 D A -0.2975
104 F A -0.4148
105 W A -0.7281
106 G A 0.0000
107 Q A -1.9565
108 G A -0.9556
109 T A -0.5499
110 T A 0.0233
111 L A 0.0000
112 T A -0.0147
113 V A 0.0000
114 S A -0.6133
115 S A -0.2777
1 D B -1.6516
2 I B -0.1365
3 V B 0.7300
4 M B 0.0000
5 T B -0.2781
6 Q B -1.0143
7 S B -1.1186
8 H B -1.4126
9 K B -1.3957
10 F B 0.4314
11 M B -0.1585
12 S B -0.5157
13 T B 0.0000
14 S B -0.7198
15 L B 0.0683
16 G B -1.1181
17 D B -2.3583
18 R B -2.6421
19 V B 0.0000
20 S B -0.4878
21 I B 0.0000
22 T B -0.3926
23 C B 0.0000
24 K B -0.9880
25 A B 0.0000
26 S B -0.9146
27 Q B -2.1163
28 D B -2.2297
29 V B 0.0000
30 G B -0.2177
31 I B 0.8212
32 D B 0.5334
33 V B 0.0000
34 A B 0.0000
35 W B 0.0000
36 H B 0.0000
37 R B -0.8738
38 Q B -1.1165
39 K B -1.4780
40 P B -1.0458
41 G B -1.4615
42 Q B -2.1524
43 S B -1.4775
44 P B 0.0000
45 K B -1.4204
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.7998
50 S B 0.7222
51 A B 0.0000
52 S B 0.3755
53 Y B 0.9323
54 R B -0.6105
55 Y B -0.1342
56 T B -0.2872
57 G B -0.7768
58 V B -0.6616
59 P B -1.2369
60 D B -2.1720
61 R B -1.4609
62 F B 0.0000
63 T B -0.5859
64 G B 0.0000
65 S B 0.0652
66 G B -0.1084
67 S B -0.2381
68 G B -0.8963
69 T B -0.8674
70 V B 0.1402
71 F B 0.0000
72 T B -0.1484
73 F B 0.0000
74 T B -0.5431
75 I B 0.0000
76 S B -1.7716
77 S B -1.4721
78 V B 0.0000
79 Q B -0.8595
80 A B -0.5410
81 E B -1.3285
82 D B 0.0000
83 L B -0.5007
84 A B 0.0000
85 V B -0.1707
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 H B 0.0000
91 H B 0.9931
92 Y B 1.8942
93 F B 2.4514
94 P B 0.9517
95 P B -0.0491
96 Y B 0.0000
97 T B 0.2531
98 F B 0.0000
99 G B 0.0000
100 G B -1.1259
101 G B 0.0000
102 T B 0.0000
103 K B -0.4637
104 L B 0.0000
105 E B -0.8371
106 I B -0.1868
107 K B -1.4307
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5727 5.0295 View CSV PDB
4.5 -0.6267 5.0245 View CSV PDB
5.0 -0.6872 5.0184 View CSV PDB
5.5 -0.7417 5.0152 View CSV PDB
6.0 -0.7781 5.0164 View CSV PDB
6.5 -0.7897 5.0182 View CSV PDB
7.0 -0.7803 5.0153 View CSV PDB
7.5 -0.76 5.0071 View CSV PDB
8.0 -0.7346 4.9961 View CSV PDB
8.5 -0.7042 4.9838 View CSV PDB
9.0 -0.667 4.9705 View CSV PDB