Project name: 7JTL_YIDI_dimer

Status: done

Started: 2026-03-26 12:00:16
Chain sequence(s) A: QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDESKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
B: QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEASPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e5af1e4e15c911e/tmp/folded.pdb                (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:37)
Show buried residues

Minimal score value
-2.905
Maximal score value
2.5454
Average score
-0.3655
Total score value
-74.2006

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
18 Q A -2.1900
19 E A -2.5740
20 C A -0.6954
21 S A -0.2769
22 L A 0.9446
23 Q A 0.1353
24 S A -0.1478
25 C A 0.0000
26 T A -0.3443
27 Q A -1.3909
28 H A -1.6328
29 Q A -1.8349
30 P A -0.6749
31 Y A 0.0422
32 V A 1.1679
33 V A 0.0000
34 D A -2.0244
35 D A -1.9883
36 P A -1.2459
37 C A -0.2321
38 P A 0.8513
39 I A 1.8672
40 H A 0.9436
41 F A 1.9121
42 Y A 0.9636
43 S A -0.3137
44 K A -0.9923
45 W A 0.0000
46 Y A 0.0000
47 I A 0.0000
48 R A -1.2846
49 V A -1.0221
50 G A -1.5652
51 A A -1.8392
52 R A -2.9050
53 K A -2.7910
54 S A -1.7194
55 A A -1.3968
56 P A -0.8859
57 L A -0.6390
58 I A -0.0466
59 E A -0.9719
60 L A 0.0000
61 C A 0.4721
62 V A -0.0335
63 D A -2.0055
64 E A -2.5024
67 S A -1.9022
68 K A -1.9586
69 S A -0.7891
70 P A -0.5184
71 I A 0.4124
72 Q A 0.2873
73 Y A 0.4217
74 I A 0.1266
75 D A -0.4640
76 I A 0.0000
77 G A -1.0961
78 N A -1.0503
79 Y A 0.0000
80 T A 0.1857
81 V A 0.8092
82 S A 1.2175
83 C A 1.9729
84 L A 2.0472
85 P A 0.9931
86 F A 0.0000
87 T A 0.0000
88 I A 0.0000
89 N A -0.8944
90 C A 0.0000
91 Q A -1.6097
92 E A -1.7167
93 P A 0.0000
94 K A -2.0817
95 L A -0.8560
96 G A -1.1240
97 S A 0.0000
98 L A 0.0000
99 V A 0.0000
100 V A 0.0000
101 R A -0.6881
102 C A 0.0000
103 S A 0.0000
104 F A 2.0911
105 Y A 0.6092
106 E A -1.4686
107 D A -1.6119
108 F A -0.1010
109 L A 0.5660
110 E A -0.5227
111 Y A 0.7166
112 H A -0.6113
113 D A -1.4013
114 V A 0.0000
115 R A -1.2936
116 V A 0.0000
117 V A 0.1029
118 L A 0.0000
119 D A -0.9714
120 F A 0.2535
121 I A 1.6469
18 Q B -2.2867
19 E B -2.5203
20 C B -0.5576
21 S B -0.0489
22 L B 0.9488
23 Q B -0.0291
24 S B -0.1362
25 C B 0.0000
26 T B -0.3714
27 Q B -1.2209
28 H B -1.6919
29 Q B -1.7964
30 P B -0.5929
31 Y B 0.1028
32 V B 1.2621
33 V B 0.0000
34 D B -1.9496
35 D B -1.9115
36 P B -1.0647
37 C B 0.0185
38 P B 1.0434
39 I B 1.8984
40 H B 1.0861
41 F B 2.1710
42 Y B 1.6185
43 S B 0.2232
44 K B -0.5436
45 W B 0.0000
46 Y B -0.2055
47 I B 0.0000
48 R B -0.9368
49 V B -0.7183
50 G B -1.2565
51 A B -1.7249
52 R B -2.7826
53 K B -2.7242
54 S B -1.6461
55 A B -1.2968
56 P B -0.6896
57 L B -0.2871
58 I B 0.3767
59 E B -0.0068
60 L B 0.0000
61 C B 0.0007
62 V B -0.9714
63 D B -2.4163
64 E B -2.5353
65 A B -1.1765
69 S B -0.8520
70 P B -0.4662
71 I B -0.4992
72 Q B -0.3676
73 Y B 0.3152
74 I B 0.8918
75 D B -0.0772
76 I B 0.0000
77 G B 0.0000
78 N B -1.0884
79 Y B 0.0000
80 T B 0.1847
81 V B 0.8919
82 S B 1.2745
83 C B 1.5482
84 L B 2.0413
85 P B 1.0257
86 F B 0.0000
87 T B 0.0000
88 I B 0.0000
89 N B -0.7423
90 C B 0.0000
91 Q B -1.3716
92 E B -1.2584
93 P B -1.2053
94 K B -1.9559
95 L B -0.7518
96 G B -0.8193
97 S B -1.0577
98 L B 0.0000
99 V B 0.0000
100 V B 0.0000
101 R B -0.6287
102 C B 0.0000
103 S B 0.0000
104 F B 2.5454
105 Y B 1.2014
106 E B -1.1494
107 D B -1.4700
108 F B -0.0058
109 L B 0.5932
110 E B -0.5886
111 Y B 0.6157
112 H B -0.7421
113 D B -1.4788
114 V B 0.0000
115 R B -1.5137
116 V B 0.0000
117 V B 0.1457
118 L B 0.0000
119 D B -0.9083
120 F B 0.3145
121 I B 1.6928
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.2857 5.5821 View CSV PDB
4.5 0.1898 5.4045 View CSV PDB
5.0 0.0737 5.196 View CSV PDB
5.5 -0.0443 4.9955 View CSV PDB
6.0 -0.1462 4.8343 View CSV PDB
6.5 -0.2201 4.7187 View CSV PDB
7.0 -0.2666 4.6353 View CSV PDB
7.5 -0.2956 4.57 View CSV PDB
8.0 -0.3137 4.518 View CSV PDB
8.5 -0.321 4.481 View CSV PDB
9.0 -0.3155 4.4569 View CSV PDB