Project name: 20 B2 2 ORIGINAL ANTIBODY

Status: done

Started: 2026-03-17 07:27:04
Chain sequence(s) A: QFVLTQPNSVSTNLGSTVKLSCKRSTGNIGSNYVNWYQQHEGRSPTTMIYRDDGRPDGVPDRFSGSIDRSSNSALLTIKNVQSEDEADYFCHSHSGGINVFGGGTSLTVLGGGGSGGGGSGGGGSEVPLVESGGGLVQPGRSLKLSCAASGFTFSNYLMAWVRHPPKKGLEWVATISSSGSRIYYPDSVKGRFTISRDNARSSLYLQMSSLRSEDTATYYCARHLRDGGFDYWGQGVMVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage A: QFVLTQPNSVSTNLGSTVKLSCKRSTGNIGSNYVNWYQQHEGRSPTTMIYRDDGRPDGVPDRFSGSIDRSSNSALLTIKNVQSEDEADYFCHSHSGGINVFGGGTSLTVLGGGG

SGGGGSGGGGSE

VPLVESGGGLVQPGRSLKLSCAASGFTFSNYLMAWVRHPPKKGLEWVATISSSGSRIYYPDSVKGRFTISRDNARSSLYLQMSSLRSEDTATYYCARHLRDGGFDYWGQGVMVTVSS
(Red indicates removed residues)
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:04)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:22)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e683848ea52b3e9/tmp/folded.pdb                (00:04:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:13)
Show buried residues

Minimal score value
-2.9879
Maximal score value
1.7474
Average score
-0.7426
Total score value
-171.5495

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.8761
2 F A 0.0000
3 V A 0.7497
4 L A 0.0000
5 T A -0.6821
6 Q A 0.0000
7 P A -1.0310
8 N A -1.5304
9 S A -0.8367
10 V A -0.4483
11 S A -0.2335
12 T A 0.0000
13 N A -1.0897
14 L A -0.6927
15 G A -1.2638
16 S A -1.1240
17 T A -1.4862
18 V A 0.0000
19 K A -1.7712
20 L A 0.0000
21 S A -0.9924
22 C A 0.0000
23 K A -2.1249
24 R A -1.2317
25 S A -0.7490
26 T A -0.8932
27 G A -1.5034
28 N A -2.4465
29 I A 0.0000
30 G A -1.4852
31 S A -0.9108
32 N A -0.8239
33 Y A -0.4642
34 V A 0.0000
35 N A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A -0.6740
39 Q A 0.0000
40 H A -2.4780
41 E A -2.9470
42 G A -2.4318
43 R A -2.9879
44 S A -1.7098
45 P A 0.0000
46 T A -0.3370
47 T A 0.0000
48 M A 0.0000
49 I A 0.0000
50 Y A -1.0131
51 R A -1.7098
52 D A -1.5405
53 D A -2.3378
54 G A -1.8917
55 R A -2.2415
56 P A -1.7943
57 D A -2.3944
58 G A -1.6401
59 V A -1.3528
60 P A -1.6364
61 D A -2.4911
62 R A -1.8933
63 F A 0.0000
64 S A -1.5536
65 G A 0.0000
66 S A -1.0706
67 I A -1.0138
68 D A -1.7704
69 R A -2.8255
70 S A -1.4167
71 S A -1.6152
72 N A -2.3110
73 S A 0.0000
74 A A 0.0000
75 L A -0.8103
76 L A 0.0000
77 T A 0.0000
78 I A 0.0000
79 K A -2.3355
80 N A -2.1505
81 V A 0.0000
82 Q A -1.8863
83 S A -1.7817
84 E A -2.5182
85 D A 0.0000
86 E A -2.2488
87 A A -1.6576
88 D A -1.2567
89 Y A 0.0000
90 F A 0.0000
91 C A 0.0000
92 H A 0.0000
93 S A 0.0000
94 H A -0.1109
95 S A -0.3657
96 G A -0.3894
97 G A 0.0000
98 I A 0.5708
99 N A 0.0000
100 V A 0.0000
101 F A 0.2258
102 G A 0.0000
103 G A -0.9787
104 G A 0.0000
105 T A 0.0000
106 S A -0.9680
107 L A 0.0000
108 T A -0.4812
109 V A 0.0000
110 L A 0.1416
111 G A -0.4651
112 G A -0.9822
113 G A -0.6957
114 G A -0.8186
127 V A 1.7474
128 P A 0.8787
129 L A 0.0000
130 V A 1.1161
131 E A 0.0000
132 S A -0.3968
133 G A -0.8619
134 G A -0.2312
135 G A 0.5549
136 L A 1.1963
137 V A 0.0000
138 Q A -1.9779
139 P A -2.2336
140 G A -2.2486
141 R A -2.7791
142 S A -2.0176
143 L A -1.3322
144 K A -1.9779
145 L A 0.0000
146 S A -0.4508
147 C A 0.0000
148 A A -0.0023
149 A A 0.0000
150 S A -0.1531
151 G A -0.2339
152 F A -0.1643
153 T A -0.4135
154 F A 0.0000
155 S A -1.0037
156 N A -1.0392
157 Y A -0.4512
158 L A -0.2870
159 M A 0.0000
160 A A 0.0000
161 W A 0.0000
162 V A 0.0000
163 R A 0.0000
164 H A -0.9511
165 P A 0.0000
166 P A -1.7949
167 K A -2.6422
168 K A -2.7913
169 G A -1.7448
170 L A 0.0000
171 E A -0.7509
172 W A 0.0000
173 V A 0.0000
174 A A 0.0000
175 T A 0.0000
176 I A 0.0000
177 S A -0.6226
178 S A -0.8412
179 S A -0.9914
180 G A -0.8888
181 S A -1.0480
182 R A -1.4991
183 I A 0.2061
184 Y A 0.1474
185 Y A -0.3988
186 P A -1.1778
187 D A -2.5412
188 S A -1.8694
189 V A 0.0000
190 K A -2.6390
191 G A -1.7395
192 R A -1.4851
193 F A 0.0000
194 T A -0.7200
195 I A 0.0000
196 S A -0.2919
197 R A -0.8402
198 D A -1.2961
199 N A -1.5472
200 A A -1.2246
201 R A -2.1691
202 S A -1.3188
203 S A -0.8239
204 L A 0.0000
205 Y A -0.5041
206 L A 0.0000
207 Q A -1.3953
208 M A 0.0000
209 S A -1.5243
210 S A -1.6520
211 L A 0.0000
212 R A -2.8684
213 S A -2.1035
214 E A -2.4703
215 D A 0.0000
216 T A -0.7678
217 A A 0.0000
218 T A -0.0354
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 A A 0.0000
223 R A 0.0000
224 H A 0.0000
225 L A -0.8918
226 R A -2.1090
227 D A -1.9040
228 G A 0.0000
229 G A 0.0000
230 F A 0.0000
231 D A -0.1592
232 Y A 0.6206
233 W A 0.0000
234 G A 0.0000
235 Q A -0.8447
236 G A 0.0000
237 V A 0.1510
238 M A 0.6497
239 V A 0.0000
240 T A -0.0668
241 V A 0.0000
242 S A -0.8874
243 S A -0.7458
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.9167 1.7019 View CSV PDB
4.5 -0.9569 1.7019 View CSV PDB
5.0 -1.0025 1.7019 View CSV PDB
5.5 -1.0467 1.7019 View CSV PDB
6.0 -1.0817 1.7019 View CSV PDB
6.5 -1.1016 1.7019 View CSV PDB
7.0 -1.1068 1.7019 View CSV PDB
7.5 -1.1028 1.7019 View CSV PDB
8.0 -1.0928 1.7019 View CSV PDB
8.5 -1.0766 1.7019 View CSV PDB
9.0 -1.0534 1.7017 View CSV PDB