Project name: Jaime

Status: error

Started: 2024-07-09 14:16:32
Chain sequence(s) A: METTKPSFQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAMGEMKNGEAK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Error log
One of Aggrescan4D modules (CABS) encountered an error. 
##############################################################################################################
[INFO]       Logger:   Verbosity set to: 4 - [DEBUG]                                               (00:00:05)
[WARNING]    JOB:      /STORAGE/DATA/lcbio/aggreskan/e68386a6ce054fa/CABS_sim already exists.      
                       Output data will be overwritten.                                            (00:00:05)
[DEBUG]      Protein:  Preparing the complex                                                       (00:00:05)
[DEBUG]      PDB:      Creating Pdb object from input.pdb                                          (00:00:05)
[DEBUG]      PDB:      Processing input.pdb                                                        (00:00:05)
[DEBUG]      PDB:      Removing alternative locations from input.pdb                               (00:00:05)
[DEBUG]      PDB:      Removing water molecules from input.pdb                                     (00:00:05)
[DEBUG]      PDB:      Scanning input.pdb for non-standard amino acids                             (00:00:05)
[DEBUG]      PDB:      Removing heteroatoms from input.pdb                                         (00:00:05)
[DEBUG]      PDB:      Selecting [name CA] from input.pdb                                          (00:00:05)
[INFO]       Protein:  Loading input.pdb as input protein                                          (00:00:05)
[DEBUG]      PDB:      Running DSSP                                                                (00:00:05)
[DEBUG]      PDB:      DSSP successful                                                             (00:00:05)
[OUT FILES]  Logger:   Saving DSSP output to /STORAGE/DATA/lcbio/aggreskan/e68386a6ce054fa/CABS_si 
                       m/output_data/DSSP_output_input.txt                                         (00:00:05)
[WARNING]    Protein:  Could not read weights file: gauss                                          (00:00:06)
[WARNING]    Protein:  Using default weights(1.0) for all atoms.                                   (00:00:06)
[DEBUG]      Protein:  Complex successfully created                                                (00:00:06)
[INFO]       CABS:     Setting up CABS simulation.                                                 (00:00:06)
[DEBUG]      CABS:     Loading structures...                                                       (00:00:06)
[DEBUG]      CABS:     Loading restraints...                                                       (00:00:07)
[DEBUG]      CABS:     Building exe...                                                             (00:00:07)
[DEBUG]      JOB:      Loading trajectories from the CABS run                                      (00:03:53)
[CRITICAL]   CABSflex: Dynamic Kabsch did not converge in 100 steps. Dynamic Kabsch did not        
                       converge in 100 steps.: Dynamic Kabsch did not converge in 100 steps.       (00:03:57)
Traceback (most recent call last):
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/__main__.py", line 55, in run
    job.run()
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/job.py", line 180, in run
    self.load_output(file_traf, file_seq)
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/job.py", line 726, in load_output
    ret = super(FlexTask, self).load_output(*args, **kwargs)
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/job.py", line 416, in load_output
    self.trajectory.superimpose_to(ic_stc, tt_stc)
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/trajectory.py", line 262, in superimpose_to
    rmsd, rot, t_com, q_com = utils.dynamic_kabsch(target, query)
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/utils.py", line 844, in dynamic_kabsch
    raise Exception('Dynamic Kabsch did not converge in %i steps.' % GAUSS_MAX_ITER)
Exception: Dynamic Kabsch did not converge in 100 steps.