Project name: e6d9e0d18fdb7bf

Status: done

Started: 2026-05-14 11:35:52
Chain sequence(s) A: EVPLVESGGGLVKPGGSLRLSCTASGFPFSRSAMSWVRQSPDKRLEWVAEISSGGFFTSYVDTVTGRFTISRDNAKNILYLEMSSLRPGDTAIYYCMAILTTTVNGVTRYTGYWGQGTSVTVSS
B: DILMTQTPSSMSVSLGDTVTITCHASRGVRSYIGWMQQKPGKSFKGLIYNGTNLEDGISSRFGGRGSGTDYSLTISGLESEDFGDYYCVQYAQFPYTFGGGTKLEVK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e6d9e0d18fdb7bf/tmp/folded.pdb                (00:02:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:47)
Show buried residues

Minimal score value
-3.6441
Maximal score value
2.162
Average score
-0.6082
Total score value
-140.4831

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7802
2 V A -0.4457
3 P A -0.1158
4 L A 0.0000
5 V A 1.5102
6 E A 0.0000
7 S A -0.4327
8 G A -1.2069
9 G A -0.4529
10 G A 0.2404
11 L A 1.0109
12 V A 0.0000
13 K A -1.9415
14 P A -1.7736
15 G A -1.5771
16 G A -1.1201
17 S A -1.4265
18 L A -1.0966
19 R A -2.4140
20 L A 0.0000
21 S A -0.4375
22 C A 0.0000
23 T A 0.1933
24 A A 0.0000
25 S A -0.5415
26 G A -0.9398
27 F A -0.5318
28 P A -0.8121
29 F A 0.0000
30 S A -1.6591
31 R A -2.0266
32 S A 0.0000
33 A A -0.2799
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 S A -2.0012
41 P A -2.0347
42 D A -3.3577
43 K A -3.6441
44 R A -3.5102
45 L A 0.0000
46 E A -1.1538
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 E A 0.0000
51 I A 0.0000
52 S A 0.2576
53 S A -0.6018
54 G A -0.2904
55 G A 0.6057
56 F A 2.1620
57 F A 1.7947
58 T A 0.8873
59 S A 0.3535
60 Y A -0.2846
61 V A 0.0000
62 D A -2.0612
63 T A -1.0612
64 V A 0.0000
65 T A -0.9702
66 G A -0.9184
67 R A -1.0763
68 F A 0.0000
69 T A -0.9219
70 I A 0.0000
71 S A -0.1570
72 R A -0.6901
73 D A -1.3936
74 N A -1.7790
75 A A -1.2562
76 K A -2.1045
77 N A -1.4396
78 I A -0.5131
79 L A 0.0000
80 Y A -0.7361
81 L A 0.0000
82 E A -2.2750
83 M A 0.0000
84 S A -1.3194
85 S A -1.2265
86 L A 0.0000
87 R A -2.4353
88 P A -1.5575
89 G A -1.1729
90 D A 0.0000
91 T A -0.3353
92 A A 0.0000
93 I A 0.0207
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 M A 0.0000
98 A A 0.0000
99 I A 0.2599
100 L A 0.0859
101 T A -0.0935
102 T A 0.0453
103 T A 0.3956
104 V A 0.6222
105 N A -0.5325
106 G A -0.0134
107 V A 1.3206
108 T A 0.5569
109 R A 0.0587
110 Y A -0.0525
111 T A -0.2223
112 G A -0.0632
113 Y A 0.0533
114 W A -0.3585
115 G A 0.0000
116 Q A -1.2701
117 G A 0.0000
118 T A -0.1781
119 S A -0.0745
120 V A 0.0000
121 T A -0.0867
122 V A 0.0000
123 S A -0.8584
124 S A -1.0016
1 D B -1.8311
2 I B 0.0000
3 L B 0.6580
4 M B 0.0000
5 T B -0.0906
6 Q B 0.0000
7 T B -0.4454
8 P B -0.4468
9 S B -0.7055
10 S B -1.0463
11 M B -0.7752
12 S B -1.0292
13 V B 0.0000
14 S B -0.8606
15 L B -0.4178
16 G B -1.1225
17 D B -1.5742
18 T B -1.0048
19 V B 0.0000
20 T B -0.3297
21 I B 0.0000
22 T B -0.6953
23 C B 0.0000
24 H B -1.1013
25 A B 0.0000
26 S B -1.0518
27 R B -2.4386
28 G B -2.1924
29 V B 0.0000
30 R B -2.3078
31 S B -1.4862
32 Y B -0.4245
33 I B 0.0000
34 G B 0.0000
35 W B 0.0000
36 M B 0.0000
37 Q B 0.0000
38 Q B -1.4749
39 K B -1.9597
40 P B -1.2786
41 G B -1.7403
42 K B -2.6880
43 S B -1.9043
44 F B 0.0000
45 K B -1.9538
46 G B -0.9908
47 L B 0.0000
48 I B 0.0000
49 Y B 0.0000
50 N B -0.6280
51 G B 0.0000
52 T B -0.9898
53 N B -0.8651
54 L B -0.4019
55 E B 0.0000
56 D B -1.9145
57 G B -1.2088
58 I B -0.8899
59 S B -0.5769
60 S B -0.5149
61 R B -0.8249
62 F B 0.0000
63 G B -0.8302
64 G B -1.2529
65 R B -2.4114
66 G B -1.9180
67 S B -1.7958
68 G B -1.7918
69 T B -1.9422
70 D B -2.1765
71 Y B 0.0000
72 S B -1.1938
73 L B 0.0000
74 T B 0.0000
75 I B 0.0000
76 S B -0.9659
77 G B -1.1623
78 L B 0.0000
79 E B -1.8786
80 S B -1.4925
81 E B -2.2242
82 D B 0.0000
83 F B -1.1002
84 G B -1.3700
85 D B -1.0956
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 V B 0.4982
90 Q B 0.0000
91 Y B 0.0454
92 A B -0.7877
93 Q B -1.1525
94 F B -0.0858
95 P B -0.5719
96 Y B 0.1216
97 T B 0.0529
98 F B 0.0345
99 G B 0.0000
100 G B -1.5118
101 G B 0.0000
102 T B 0.0000
103 K B -1.6788
104 L B 0.0000
105 E B -1.7272
106 V B -0.4996
107 K B -1.4325
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6083 5.101 View CSV PDB
4.5 -0.6472 5.101 View CSV PDB
5.0 -0.6925 5.101 View CSV PDB
5.5 -0.7354 5.101 View CSV PDB
6.0 -0.7672 5.101 View CSV PDB
6.5 -0.7827 5.101 View CSV PDB
7.0 -0.7824 5.101 View CSV PDB
7.5 -0.7706 5.101 View CSV PDB
8.0 -0.7516 5.101 View CSV PDB
8.5 -0.7268 5.101 View CSV PDB
9.0 -0.6962 5.101 View CSV PDB