Project name: e6ddac69af8d818

Status: done

Started: 2026-02-19 17:56:30
Chain sequence(s) B: NTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRD
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:59)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e6ddac69af8d818/tmp/folded.pdb                (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)
Show buried residues

Minimal score value
-3.5368
Maximal score value
2.1672
Average score
-0.7256
Total score value
-85.6185

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
20 N B -1.3452
21 T B -0.5292
22 T B 0.2301
23 V B 0.9230
24 F B 0.0509
25 Q B -0.9386
26 G B 0.0000
27 V B -0.8883
28 A B -1.6403
29 G B -2.0275
30 Q B -2.3795
31 S B -2.1386
32 L B 0.0000
33 Q B -1.6762
34 V B 0.0000
35 S B -0.2460
36 C B 0.0000
37 P B -0.7201
38 Y B -1.0121
39 D B -1.8730
40 S B -0.6673
41 M B -0.1346
42 K B -1.6000
43 H B 0.0000
44 W B 0.0166
45 G B -0.0525
46 R B -1.1862
47 R B -0.9899
48 K B 0.0000
49 A B 0.0000
50 W B 0.0000
51 C B 0.0000
52 R B -1.1109
53 Q B -0.8318
54 L B 0.2970
55 G B -0.9883
56 E B -2.5047
57 K B -2.4941
58 G B -1.4541
59 P B -1.1764
60 C B -1.1911
61 Q B -1.7966
62 R B -2.1548
63 V B -1.1420
64 V B 0.0000
65 S B -1.0310
66 T B 0.0000
67 H B -0.3308
68 N B -0.8320
69 L B 0.7514
70 W B 1.0739
71 L B 2.1672
72 L B 1.7366
73 S B 0.0000
74 F B 2.0153
75 L B 0.7525
76 R B -0.8072
77 R B -1.3113
78 W B -0.8948
79 N B -1.4076
80 G B -1.2337
81 S B -1.2914
82 T B -1.0440
83 A B 0.0000
84 I B 0.0000
85 T B -0.0254
86 D B 0.0000
87 D B -0.0499
88 T B 0.9822
89 L B 1.2103
90 G B -0.2476
91 G B 0.0000
92 T B -0.5324
93 L B 0.0000
94 T B -0.4297
95 I B 0.0000
96 T B 0.0000
97 L B 0.0000
98 R B -2.5882
99 N B -2.7136
100 L B 0.0000
101 Q B -1.9549
102 P B -1.2094
103 H B -1.6663
104 D B -1.6277
105 A B -1.0659
106 G B -0.1412
107 L B 0.2624
108 Y B 0.0000
109 Q B 0.0000
110 C B 0.0000
111 Q B -1.3030
112 S B 0.0000
113 L B -1.7247
114 H B -2.3207
115 G B -1.7042
116 S B -1.5348
117 E B -2.6290
118 A B -2.0697
119 D B -2.0981
120 T B -1.0060
121 L B -0.8734
122 R B -1.1272
123 K B -1.0499
124 V B 0.0000
125 L B 0.4485
126 V B 0.0000
127 E B -0.9000
128 V B -0.8801
129 L B -0.2421
130 A B -0.1452
131 D B -0.9239
132 P B -0.3552
133 L B -0.2395
134 D B -2.4941
135 H B -2.8949
136 R B -3.5368
137 D B -3.1580
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4237 4.0592 View CSV PDB
4.5 -0.4833 4.0006 View CSV PDB
5.0 -0.5499 3.9388 View CSV PDB
5.5 -0.6136 3.8728 View CSV PDB
6.0 -0.6683 3.8032 View CSV PDB
6.5 -0.7127 3.7319 View CSV PDB
7.0 -0.7486 3.6608 View CSV PDB
7.5 -0.778 3.5921 View CSV PDB
8.0 -0.8011 3.5307 View CSV PDB
8.5 -0.8146 3.4843 View CSV PDB
9.0 -0.8153 3.4579 View CSV PDB