Project name: ok 10

Status: done

Started: 2026-03-17 06:57:35
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASQSVSYMNWYQQKPGQAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLWMGYINPSRGYTNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:13)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:14)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:14)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:54)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e6f21cbbda1e834/tmp/folded.pdb                (00:03:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:01)
Show buried residues

Minimal score value
-3.5444
Maximal score value
1.0543
Average score
-0.7682
Total score value
-183.6066

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8450
2 I A 0.0000
3 V A 0.8778
4 L A 0.0000
5 T A -0.2725
6 K A -0.5096
7 S A -0.4848
8 P A -0.4014
9 A A -0.5148
10 T A -0.4918
11 L A -0.3432
12 S A -0.8116
13 L A -1.0778
14 S A -1.6195
15 P A -1.9559
16 G A -2.2610
17 E A -2.8748
18 R A -3.2350
19 A A 0.0000
20 T A -0.6277
21 L A 0.0000
22 S A -0.6943
23 C A 0.0000
24 S A -0.9530
25 A A 0.0000
26 S A -0.7178
27 Q A -1.5701
28 S A -1.3010
29 V A 0.0000
30 S A -0.5384
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 Q A -0.4844
37 Q A 0.0000
38 K A -1.4874
39 P A -1.0675
40 G A -1.3195
41 Q A -1.8289
42 A A -1.1287
43 P A 0.0000
44 R A -0.7890
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3778
49 D A -1.0171
50 T A -0.6559
51 S A -0.6760
52 N A -0.5705
53 L A -0.1205
54 A A 0.0000
55 T A -0.2200
56 G A -0.6613
57 I A -0.4057
58 P A -0.9434
59 D A -1.8763
60 R A -1.8935
61 F A 0.0000
62 S A -0.6643
63 G A 0.0000
64 S A -0.9505
65 G A -1.2130
66 S A -1.1202
67 G A -1.2281
68 T A -1.5918
69 D A -2.2842
70 F A 0.0000
71 T A -0.7430
72 L A 0.0000
73 T A -0.8004
74 I A 0.0000
75 S A -2.4257
76 R A -3.3279
77 L A 0.0000
78 E A -2.4947
79 P A -1.7345
80 E A -2.5268
81 D A 0.0000
82 F A -0.9300
83 A A 0.0000
84 V A -0.4086
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0732
91 S A -0.3008
92 S A -1.2386
93 N A -1.7440
94 P A -1.4839
95 F A 0.0000
96 T A 0.0000
97 F A 0.1162
98 G A 0.0000
99 Q A -1.5351
100 G A 0.0000
101 T A 0.0000
102 K A -1.2302
103 L A 0.0000
104 E A -1.1208
105 I A -1.0373
106 K A -1.9875
107 G A -1.5451
108 G A -1.3999
109 G A -1.2812
110 G A -1.3594
111 S A -1.0258
112 G A -1.5920
113 G A -1.6266
114 G A -1.7873
115 G A -1.6010
116 S A -1.1977
117 G A -1.2596
118 G A -1.2228
119 G A -1.3790
120 G A -1.4199
121 S A -1.4012
122 Q A -1.7551
123 V A -1.1499
124 Q A -1.7163
125 L A 0.0000
126 V A -0.5695
127 Q A 0.0000
128 S A -0.7042
129 G A -0.5839
130 A A 0.1696
131 E A -0.2756
132 V A 0.8836
133 K A -0.9525
134 K A -2.0625
135 P A -2.0521
136 G A -1.4522
137 A A -1.1496
138 S A -1.2574
139 V A 0.0000
140 K A -2.0154
141 V A 0.0000
142 S A -0.7736
143 C A 0.0000
144 K A -1.4557
145 A A 0.0000
146 S A -0.9896
147 G A -0.9129
148 Y A -0.5597
149 T A -0.5033
150 F A 0.0000
151 T A -1.3045
152 R A -1.9400
153 Y A -0.9532
154 T A -0.6107
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.2360
161 A A -0.6353
162 P A -0.8536
163 G A -1.4311
164 Q A -1.5552
165 G A 0.0000
166 L A -0.3649
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.2160
171 I A 0.0000
172 N A -0.7498
173 P A 0.0000
174 S A -1.4351
175 R A -1.6775
176 G A -0.7789
177 Y A 0.5048
178 T A 0.2110
179 N A -0.3552
180 Y A -1.3175
181 A A -1.8597
182 Q A -2.9273
183 K A -3.0288
184 F A 0.0000
185 K A -3.5444
186 D A -3.2663
187 R A -2.2408
188 V A 0.0000
189 T A -1.0275
190 M A 0.0000
191 T A -0.4716
192 R A -1.6120
193 D A -1.3949
194 T A -0.8147
195 S A -0.6118
196 T A -0.7675
197 S A -0.8891
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7514
201 M A 0.0000
202 E A -1.2909
203 L A 0.0000
204 S A -1.2194
205 S A -1.2282
206 L A 0.0000
207 R A -2.6101
208 S A -2.1566
209 E A -2.3841
210 D A 0.0000
211 T A -0.6474
212 A A 0.0000
213 V A 0.6029
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1034
221 D A -2.4370
222 D A -2.5060
223 H A -1.4457
224 Y A -0.4365
225 C A 0.0000
226 L A 0.0000
227 D A -0.1241
228 Y A -0.1649
229 W A -0.4068
230 G A 0.0000
231 Q A -1.3410
232 G A -0.4508
233 T A 0.0000
234 L A 1.0543
235 V A 0.0000
236 T A -0.0978
237 V A 0.0000
238 S A -0.8330
239 S A -1.1438
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7454 1.7518 View CSV PDB
4.5 -0.7905 1.7201 View CSV PDB
5.0 -0.8428 1.6704 View CSV PDB
5.5 -0.8934 1.6105 View CSV PDB
6.0 -0.9333 1.565 View CSV PDB
6.5 -0.9554 1.565 View CSV PDB
7.0 -0.9599 1.565 View CSV PDB
7.5 -0.9526 1.565 View CSV PDB
8.0 -0.9382 1.6052 View CSV PDB
8.5 -0.9174 1.6562 View CSV PDB
9.0 -0.8887 1.7043 View CSV PDB