Project name: ValAla_R2

Status: done

Started: 2026-08-20 09:16:54
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e715ad97a977455/tmp/folded.pdb                (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:21)
Show buried residues

Minimal score value
-2.699
Maximal score value
1.937
Average score
-0.5253
Total score value
-130.2713

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6947
2 V A 0.0000
3 Q A -2.0663
4 L A 0.0000
5 Q A -1.8475
6 E A 0.0000
7 S A -0.6905
8 G A -0.3785
9 P A 0.0458
10 G A 0.3924
11 L A 0.9744
12 V A 0.0000
13 K A -1.8355
14 P A -1.3243
15 S A -1.3998
16 Q A -1.9415
17 T A -1.5763
18 L A 0.0000
19 S A -0.9951
20 L A 0.0000
21 T A -0.6306
22 V A 0.0000
23 T A -1.2356
24 V A 0.0000
25 S A -1.3947
26 G A -1.4194
27 G A -1.0834
28 S A -0.7147
29 I A 0.0000
30 S A -0.2104
31 S A -0.3100
32 G A -0.0860
33 D A -0.0317
34 Y A 0.6251
35 Y A 0.6476
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6866
43 P A -0.6595
44 G A -1.1200
45 C A -1.2164
46 K A -2.0095
47 G A -1.2009
48 L A 0.0000
49 E A -0.6764
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1692
54 I A 0.0000
55 Y A 0.3764
56 Y A 0.4205
57 S A -0.0825
58 G A -0.2023
59 S A -0.2076
60 T A -0.1813
61 D A -0.6145
62 Y A -0.7475
63 N A -0.9651
64 P A -1.2734
65 S A -1.1839
66 L A 0.0000
67 K A -2.1414
68 S A -1.4210
69 R A -1.5940
70 V A 0.0000
71 T A -1.0832
72 M A 0.0000
73 S A -0.3750
74 V A -0.3302
75 D A -1.1798
76 T A -1.0007
77 S A -1.3255
78 K A -2.1690
79 N A -1.4334
80 Q A -1.3174
81 F A 0.0000
82 S A -0.5592
83 L A 0.0000
84 K A -1.6190
85 V A 0.0000
86 N A -1.6366
87 S A -1.4770
88 V A 0.0000
89 T A -0.6673
90 A A -0.3967
91 A A -0.2449
92 D A 0.0000
93 T A 0.3009
94 A A 0.0000
95 V A 0.2487
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.4824
104 F A 1.9370
105 G A 0.6398
106 V A 0.6098
107 G A 0.7749
108 T A 0.0000
109 F A 0.0000
110 D A -0.4512
111 Y A -0.5358
112 W A -0.7878
113 G A 0.0000
114 Q A -1.6378
115 G A -0.7398
116 T A -0.1568
117 L A 0.8893
118 V A 0.0000
119 T A 0.3637
120 V A 0.0000
121 S A -0.3827
122 S A -0.7272
123 A A -0.6434
124 A A -0.3667
125 G A -0.8417
126 G A -1.0834
127 G A -1.1538
128 G A -1.1806
129 S A -1.0227
130 G A -1.1952
131 G A -1.2048
132 G A -1.2164
133 G A -1.2105
134 S A -0.9656
135 G A -1.2264
136 G A -1.1455
137 G A -1.2638
138 G A -1.2319
139 S A -0.8234
140 D A -0.7810
141 I A -0.0519
142 V A 0.9773
143 M A 0.0000
144 T A -0.5685
145 Q A -0.7556
146 S A -0.7328
147 P A -0.3655
148 A A -0.3262
149 T A -0.4020
150 L A -0.1506
151 S A -0.3142
152 L A -0.6702
153 S A -0.9977
154 P A -1.4610
155 G A -1.8134
156 E A -2.4340
157 R A -2.6990
158 A A 0.0000
159 T A -0.6614
160 L A 0.0000
161 S A -0.8676
162 V A 0.0000
163 R A -2.3049
164 A A 0.0000
165 S A -0.8187
166 Q A -1.5385
167 S A -1.2024
168 V A 0.0000
169 S A -0.4345
170 S A -0.1208
171 Y A 0.8255
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.2780
179 P A -0.9436
180 G A -0.9936
181 C A -1.1519
182 Q A -1.6092
183 A A -1.1764
184 P A 0.0000
185 R A -1.3384
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.3364
190 D A -0.4312
191 A A 0.0000
192 S A -0.9152
193 N A -1.3790
194 R A -1.5924
195 A A -0.9914
196 T A -0.6462
197 G A -0.6729
198 I A 0.0000
199 P A -0.4489
200 A A -0.3943
201 R A -0.7065
202 F A 0.0000
203 S A -0.7073
204 G A 0.0000
205 S A -0.7547
206 G A -1.0561
207 S A -0.8919
208 G A -1.0233
209 T A -1.7091
210 D A -2.0872
211 F A 0.0000
212 T A -0.7364
213 L A 0.0000
214 T A -0.5930
215 I A 0.0000
216 S A -1.3624
217 S A -1.7418
218 L A 0.0000
219 E A -2.1275
220 P A -1.3210
221 E A -2.0303
222 D A 0.0000
223 F A -0.5733
224 A A 0.0000
225 V A -0.5339
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3110
232 G A 0.0539
233 S A -0.1631
234 T A -0.3725
235 P A -0.3876
236 L A 0.0000
237 T A 0.2244
238 F A 0.2722
239 G A 0.0000
240 G A -0.7794
241 G A -0.7252
242 T A 0.0000
243 K A -0.7015
244 A A 0.0000
245 E A -0.4054
246 I A 0.7216
247 K A -0.8851
248 A A -0.3481
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4841 4.9352 View CSV PDB
4.5 -0.5018 4.9327 View CSV PDB
5.0 -0.5221 4.9255 View CSV PDB
5.5 -0.5399 4.9078 View CSV PDB
6.0 -0.5492 4.875 View CSV PDB
6.5 -0.546 4.8293 View CSV PDB
7.0 -0.5308 4.7769 View CSV PDB
7.5 -0.5075 4.7219 View CSV PDB
8.0 -0.4798 4.6661 View CSV PDB
8.5 -0.4491 4.61 View CSV PDB
9.0 -0.416 4.5541 View CSV PDB