Project name: e721325166ac78e

Status: done

Started: 2026-04-09 07:24:38
Chain sequence(s) A: QAVVTQEPSLTVSPGGTVTLTCRLSTGAVTTSNYANWVQQKPGQAPRGLIGGTNNRAPGTPARFSGSLLGDKAALTLSGAQPEDEAEYYCVLWYSNHWVFGGGTKLTVLGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAYISSGSSTIYYADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVRAEITTVVADYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e721325166ac78e/tmp/folded.pdb                (00:01:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:33)
Show buried residues

Minimal score value
-2.8425
Maximal score value
1.3358
Average score
-0.5931
Total score value
-147.0993

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7732
2 A A 0.0000
3 V A 1.3358
4 V A 0.0000
5 T A -0.1233
6 Q A -0.6619
7 E A -0.9743
8 P A -0.9690
9 S A -0.7623
10 L A -0.1127
11 T A 0.0622
12 V A 0.0000
13 S A -0.2572
14 P A -0.6415
15 G A -0.8656
16 G A -0.4764
17 T A -0.3638
18 V A 0.0148
19 T A 0.1806
20 L A 0.0000
21 T A -0.1915
22 C A 0.0000
23 R A -0.6532
24 L A 0.0000
25 S A 0.0144
26 T A -0.1224
27 G A -0.6360
28 A A -0.6505
29 V A 0.0000
30 T A -0.1833
31 T A -0.1577
32 S A -0.0318
33 N A 0.0000
34 Y A 0.0086
35 A A 0.0000
36 N A 0.0000
37 W A 0.0000
38 V A 0.0000
39 Q A 0.0000
40 Q A 0.0000
41 K A -2.0753
42 P A -1.4173
43 G A -1.3168
44 Q A -2.0035
45 A A -1.3292
46 P A 0.0000
47 R A -1.0690
48 G A 0.0000
49 L A 0.0000
50 I A 0.0000
51 G A 0.0000
52 G A -0.9383
53 T A 0.0000
54 N A -2.3328
55 N A -2.7526
56 R A -2.8425
57 A A 0.0000
58 P A -1.0675
59 G A -0.9063
60 T A -1.1433
61 P A -0.6779
62 A A -0.6114
63 R A -0.6751
64 F A 0.0000
65 S A -1.1940
66 G A 0.0000
67 S A -0.2695
68 L A 0.4532
69 L A 0.9108
70 G A -0.3204
71 D A -1.1096
72 K A -0.6631
73 A A 0.0000
74 A A 0.0000
75 L A 0.0000
76 T A -0.1973
77 L A 0.0000
78 S A -0.5820
79 G A -0.7422
80 A A 0.0000
81 Q A -1.6086
82 P A -1.8409
83 E A -2.5422
84 D A 0.0000
85 E A -2.1246
86 A A 0.0000
87 E A -1.6736
88 Y A 0.0000
89 Y A 0.0000
90 C A 0.0000
91 V A 0.0000
92 L A 0.0000
93 W A 0.2528
94 Y A 0.2371
95 S A -0.4922
96 N A -0.4968
97 H A -0.2991
98 W A 0.0000
99 V A 0.0000
100 F A 0.2098
101 G A 0.0000
102 G A -0.9580
103 G A -1.1209
104 T A 0.0000
105 K A -1.4868
106 L A 0.0000
107 T A -0.7232
108 V A 0.0000
109 L A 0.4477
110 G A -0.4153
111 G A -1.2707
112 G A -0.9979
113 G A -1.2201
114 S A -1.0133
115 G A -1.1318
116 G A -1.2121
117 G A -1.1740
118 G A -1.1788
119 S A -1.0310
120 G A -1.1658
121 G A -1.1856
122 G A -1.1921
123 G A -1.1387
124 S A -1.0006
125 G A -1.1212
126 G A -1.3662
127 G A -1.3415
128 G A -1.4306
129 S A -1.5997
130 E A -2.2875
131 V A -1.1156
132 Q A -1.1108
133 L A 0.0000
134 V A 0.4789
135 E A 0.0000
136 S A -0.5522
137 G A -1.0076
138 G A -0.4082
139 G A 0.2515
140 L A 1.1982
141 V A -0.0120
142 Q A -1.2919
143 P A -1.5511
144 G A -1.4448
145 G A -1.0262
146 S A -1.4412
147 L A -1.0048
148 R A -2.1746
149 L A 0.0000
150 S A -0.4930
151 C A 0.0000
152 A A -0.3338
153 A A 0.0000
154 S A -0.9704
155 G A -1.0704
156 F A -0.6574
157 T A -0.6853
158 F A 0.0000
159 S A -1.4386
160 D A -1.9199
161 Y A -0.7320
162 G A 0.0000
163 M A 0.0000
164 H A 0.0000
165 W A 0.0000
166 V A 0.0000
167 R A 0.0000
168 Q A -0.7920
169 A A -1.2186
170 P A -1.1751
171 G A -1.4574
172 K A -2.2733
173 G A -1.5156
174 L A 0.0000
175 E A -0.8868
176 W A 0.0000
177 V A 0.0000
178 A A 0.0000
179 Y A 0.0000
180 I A 0.0000
181 S A -0.3189
182 S A -1.0642
183 G A -0.9884
184 S A -0.4914
185 S A -0.2463
186 T A 0.1878
187 I A 0.8908
188 Y A 0.2652
189 Y A -0.6166
190 A A -1.3919
191 D A -2.4256
192 T A -1.7122
193 V A 0.0000
194 K A -2.5571
195 G A -1.8514
196 R A -1.7911
197 F A 0.0000
198 T A -0.8727
199 I A 0.0000
200 S A -0.2953
201 R A -1.0423
202 D A -1.5933
203 N A -2.0037
204 A A -1.4390
205 K A -2.3855
206 N A -1.9213
207 S A -1.1632
208 L A 0.0000
209 Y A -0.5802
210 L A 0.0000
211 Q A -1.5669
212 M A 0.0000
213 N A -2.0617
214 S A -1.4570
215 L A 0.0000
216 R A -2.2280
217 A A -1.6548
218 E A -2.2054
219 D A 0.0000
220 T A -0.6186
221 A A 0.0000
222 V A 0.1667
223 Y A 0.0000
224 Y A 0.0000
225 C A 0.0000
226 V A 0.0000
227 R A 0.0000
228 A A 0.0000
229 E A -0.3390
230 I A 0.0370
231 T A 0.0726
232 T A -0.1026
233 V A -0.1304
234 V A 0.0000
235 A A 0.0000
236 D A -0.4689
237 Y A -0.1740
238 W A -0.2409
239 G A 0.0000
240 Q A -1.2554
241 G A 0.0000
242 T A -0.2191
243 T A 0.1373
244 V A 0.0000
245 T A -0.0022
246 V A 0.0000
247 S A -0.4516
248 S A -0.5385
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3584 1.6568 View CSV PDB
4.5 -0.3885 1.6568 View CSV PDB
5.0 -0.4231 1.6568 View CSV PDB
5.5 -0.4566 1.6568 View CSV PDB
6.0 -0.4834 1.6568 View CSV PDB
6.5 -0.499 1.6568 View CSV PDB
7.0 -0.503 1.6568 View CSV PDB
7.5 -0.4992 1.6568 View CSV PDB
8.0 -0.4906 1.6568 View CSV PDB
8.5 -0.4778 1.6568 View CSV PDB
9.0 -0.4607 1.6568 View CSV PDB