Project name: e82fdae6417f2d1

Status: done

Started: 2026-07-22 15:35:42
Chain sequence(s) A: DIQMTQSPSSVSASVGDRVTITCHASQNINVWLTWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGQSYPWTFGGGTKVEIK
B: EVQLLESGPGLVKPSETLSLTCTVSGFSLTGYGVNWIRQPPGKGLEWVGMIWVDGSTDYNSALKSRVTISVDTSKNQFYLKLSSVTAADTAVYYCARGGYGAMDYWGQGTLVTVSSTVTVSSA
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:30)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e82fdae6417f2d1/tmp/folded.pdb                (00:01:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:33)
Show buried residues

Minimal score value
-2.7423
Maximal score value
2.0031
Average score
-0.5433
Total score value
-124.9571

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -2.1384
2 I A -1.8003
3 Q A -1.9350
4 M A 0.0000
5 T A -0.9730
6 Q A -0.7830
7 S A -0.5657
8 P A -0.5643
9 S A -0.7418
10 S A -0.9044
11 V A -0.6027
12 S A -1.0194
13 A A 0.0000
14 S A -0.7270
15 V A 0.1533
16 G A -0.7542
17 D A -1.5739
18 R A -2.3075
19 V A 0.0000
20 T A -0.6238
21 I A 0.0000
22 T A -0.7202
23 C A 0.0000
24 H A -1.8804
25 A A 0.0000
26 S A -1.9062
27 Q A -2.7423
28 N A -2.5573
29 I A 0.0000
30 N A -1.9376
31 V A -0.8388
32 W A -0.4327
33 L A 0.0000
34 T A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.3576
39 K A -1.8774
40 P A -1.3389
41 G A -1.7351
42 K A -2.6826
43 A A -1.6601
44 P A 0.0000
45 K A -1.4125
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0106
50 K A -0.7244
51 A A 0.0000
52 S A -0.5750
53 N A -0.5633
54 L A 0.0248
55 H A -0.2691
56 T A -0.3396
57 G A -0.4929
58 V A 0.0000
59 P A -0.3620
60 S A -0.4272
61 R A -0.7268
62 F A 0.0000
63 S A -0.3966
64 G A -0.4285
65 S A -0.8208
66 G A -1.2204
67 S A -1.3614
68 G A -1.8105
69 T A -2.0882
70 D A -2.4607
71 F A 0.0000
72 T A -0.7175
73 L A 0.0000
74 T A -0.6159
75 I A 0.0000
76 S A -1.3193
77 S A -1.1238
78 L A 0.0000
79 Q A -0.8951
80 P A -1.0380
81 E A -1.6913
82 D A 0.0000
83 F A -0.5796
84 A A 0.0000
85 T A -0.8780
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A -0.2029
92 Q A -0.9878
93 S A -0.3888
94 Y A -0.1420
95 P A -0.4254
96 W A 0.0000
97 T A -0.6566
98 F A -0.2960
99 G A 0.0000
100 G A -1.1602
101 G A -0.9393
102 T A 0.0000
103 K A -1.4181
104 V A 0.0000
105 E A -1.5376
106 I A -0.9596
107 K A -1.5787
1 E B -2.0953
2 V B -1.1865
3 Q B -1.1936
4 L B 0.0000
5 L B 0.4025
6 E B 0.0000
7 S B -0.0566
8 G B -0.4546
9 P B -0.2250
10 G B 0.2630
11 L B 0.3059
12 V B 0.0000
13 K B -1.8311
14 P B -1.5905
15 S B -1.6722
16 E B -2.5257
17 T B -1.7094
18 L B 0.0000
19 S B -0.9655
20 L B 0.0000
21 T B -0.1581
22 C B 0.0000
23 T B -0.4819
24 V B 0.0000
25 S B -1.1368
26 G B -1.2495
27 F B -0.4658
28 S B -0.1994
29 L B 0.0923
30 T B -0.1948
31 G B -0.1385
32 Y B 0.3824
33 G B 0.0000
34 V B 0.0000
35 N B 0.0000
36 W B 0.0000
37 I B 0.0000
38 R B 0.0000
39 Q B -0.6273
40 P B -0.7375
41 P B -0.8342
42 G B -1.5064
43 K B -2.2654
44 G B -1.3912
45 L B 0.0000
46 E B -0.8432
47 W B 0.0000
48 V B 0.0000
49 G B 0.0000
50 M B 0.0000
51 I B 0.0000
52 W B -0.2028
53 V B -0.3534
54 D B -1.5712
55 G B -0.9686
56 S B -0.7532
57 T B -0.6138
58 D B -0.8584
59 Y B -0.8333
60 N B -0.9941
61 S B -1.1603
62 A B -0.8104
63 L B 0.0000
64 K B -2.0934
65 S B -1.3027
66 R B -1.3809
67 V B 0.0000
68 T B -0.9813
69 I B 0.0000
70 S B -0.1751
71 V B -0.5062
72 D B -1.1404
73 T B -1.2851
74 S B -1.3920
75 K B -2.3227
76 N B -1.6641
77 Q B -1.1603
78 F B 0.0000
79 Y B -0.1618
80 L B 0.0000
81 K B -1.3787
82 L B 0.0000
83 S B -1.3056
84 S B -1.3252
85 V B 0.0000
86 T B -0.6808
87 A B -0.1959
88 A B 0.0532
89 D B 0.0000
90 T B 0.3158
91 A B 0.0000
92 V B 0.6617
93 Y B 0.0000
94 Y B 0.0000
95 C B 0.0000
96 A B 0.0000
97 R B 0.0000
98 G B 0.0000
99 G B 0.2042
100 Y B 0.3350
101 G B 0.0000
102 A B 0.0000
103 M B 0.0000
104 D B -0.0077
105 Y B 0.0964
106 W B -0.2893
107 G B 0.0000
108 Q B -1.3978
109 G B 0.0000
110 T B 0.5135
111 L B 1.5224
112 V B 0.0000
113 T B 0.2931
114 V B 0.0000
115 S B -0.3457
116 S B -0.1361
117 T B 0.4518
118 V B 1.8753
119 T B 1.5368
120 V B 2.0031
121 S B 0.7297
122 S B 0.1096
123 A B -0.0962
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5603 2.479 View CSV PDB
4.5 -0.5924 2.479 View CSV PDB
5.0 -0.6291 2.479 View CSV PDB
5.5 -0.6614 2.479 View CSV PDB
6.0 -0.6801 2.479 View CSV PDB
6.5 -0.6802 2.479 View CSV PDB
7.0 -0.6637 2.479 View CSV PDB
7.5 -0.6362 2.479 View CSV PDB
8.0 -0.6021 2.479 View CSV PDB
8.5 -0.5627 2.479 View CSV PDB
9.0 -0.5184 2.479 View CSV PDB