Project name: e97422d67b53808

Status: done

Started: 2026-04-10 02:51:38
Chain sequence(s) B: ILTHPHLFWLSLGGLLLAAEMLGGSGYLLWSGVAGVVTGALTWLLPLSWEWQGTLFAVLTLLAAWLWSKWLRKRVKTQRPADAQLNQRGQQLVGRRLTLDAPLVNGRGHVRVGDSSWPVIADEDFAAGSKVEVIAVEGITLRIRPAVR
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:29)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e97422d67b53808/tmp/folded.pdb                (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.9301
Maximal score value
2.8189
Average score
-0.1983
Total score value
-29.3527

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
5 I B 2.8189
6 L B 2.4900
7 T B 0.8860
8 H B 0.6482
9 P B 1.2942
10 H B 1.9011
11 L B 2.4620
12 F B 2.5294
13 W B 0.0000
14 L B 2.2221
15 S B 1.5308
16 L B 1.7771
17 G B 0.0000
18 G B 1.0829
19 L B 1.8118
20 L B 1.7328
21 L B 1.6309
22 A B 1.4404
23 A B 1.2673
24 E B 1.2536
25 M B 1.5286
26 L B 1.6717
27 G B 0.2839
28 G B 0.1911
29 S B 0.1760
30 G B 0.6343
31 Y B 1.4857
32 L B 1.5348
33 L B 1.1642
34 W B 1.6170
35 S B 1.5003
36 G B 0.0000
37 V B 1.5700
38 A B 0.0000
39 G B 0.0000
40 V B 2.1370
41 V B 1.8539
42 T B 0.0000
43 G B 0.0000
44 A B 1.9206
45 L B 1.9482
46 T B 0.0000
47 W B 2.3752
48 L B 2.6492
49 L B 2.0105
50 P B 1.1886
51 L B 1.0068
52 S B 0.3388
53 W B 0.5472
54 E B -0.7819
55 W B 0.6426
56 Q B 0.0000
57 G B 0.1810
58 T B 0.6332
59 L B 1.2868
60 F B 1.5774
61 A B 1.3883
62 V B 2.4478
63 L B 2.2417
64 T B 1.9461
65 L B 2.4326
66 L B 2.5390
67 A B 2.1861
68 A B 1.8876
69 W B 2.4699
70 L B 2.6876
71 W B 1.6659
72 S B 0.2990
73 K B -0.7982
74 W B 0.3118
75 L B -0.3934
76 R B -2.8011
77 K B -3.2679
78 R B -2.9633
79 V B -2.8115
80 K B -3.4255
81 T B -2.2850
82 Q B -2.9830
83 R B -3.2865
84 P B -2.0877
85 A B -1.5607
86 D B -2.2527
87 A B -2.0023
88 Q B -2.4502
89 L B -1.1439
90 N B -2.4457
91 Q B -3.2871
92 R B -3.2269
93 G B -2.0675
94 Q B -2.2222
95 Q B -2.2860
96 L B 0.0000
97 V B -0.6788
98 G B -1.0817
99 R B -2.1534
100 R B -3.0950
101 L B -1.6078
102 T B -1.4131
103 L B 0.0000
104 D B -2.3546
105 A B -0.9347
106 P B -1.0108
107 L B 0.0000
108 V B -0.0833
109 N B -1.9279
110 G B 0.0000
111 R B -2.7200
112 G B -1.4291
113 H B -1.9826
114 V B 0.0000
115 R B -2.7609
116 V B -1.4609
117 G B -1.6984
118 D B -2.4798
119 S B -1.6991
120 S B -1.6214
121 W B -0.3623
122 P B -0.6602
123 V B 0.0000
124 I B -2.0546
125 A B -2.9503
126 D B -3.7808
127 E B -3.9301
128 D B -3.0980
129 F B -1.8315
130 A B -0.6694
131 A B -1.0982
132 G B -1.1148
133 S B -0.9545
134 K B -1.4277
135 V B 0.0000
136 E B -2.0397
137 V B 0.0000
138 I B 0.1292
139 A B -0.0944
140 V B -0.0851
141 E B -1.3155
142 G B -0.2588
143 I B 1.2800
144 T B -0.0813
145 L B 0.0000
146 R B -1.3018
147 I B 0.0000
148 R B -2.8454
149 P B -1.4409
150 A B -0.6436
151 V B 0.6726
152 R B -1.3096
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.1721 5.4701 View CSV PDB
4.5 0.1148 5.4715 View CSV PDB
5.0 0.0484 5.4757 View CSV PDB
5.5 -0.0158 5.4877 View CSV PDB
6.0 -0.0659 5.5162 View CSV PDB
6.5 -0.0953 5.5668 View CSV PDB
7.0 -0.1082 5.635 View CSV PDB
7.5 -0.1128 5.7117 View CSV PDB
8.0 -0.1123 5.7917 View CSV PDB
8.5 -0.1045 5.8725 View CSV PDB
9.0 -0.0862 5.9529 View CSV PDB