Project name: e9fec4b1cb366b8

Status: done

Started: 2026-04-11 08:24:29
Chain sequence(s) A: QKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSADNYGQNFVFGPGTRLSVLPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYSVGEGNLGDTQYFGPGTRLTVL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:06)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:06)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:06)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:15)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/e9fec4b1cb366b8/tmp/folded.pdb                (00:02:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:44)
Show buried residues

Minimal score value
-3.662
Maximal score value
1.543
Average score
-0.7267
Total score value
-183.8634

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -2.4136
2 K A -3.0671
3 E A -2.3721
4 V A 0.0000
5 E A -2.6193
6 Q A -1.6904
7 D A -2.0921
8 P A -1.6209
9 G A -1.4772
10 P A -1.3463
11 L A -0.6277
12 S A -0.2179
13 V A 0.2900
14 P A -0.4655
15 E A -1.4427
16 G A -1.5934
17 A A -0.4044
18 I A 0.7551
19 V A 0.0000
20 S A 0.1034
21 L A 0.0000
22 N A -0.9038
23 C A 0.0000
24 T A -1.2961
25 Y A 0.0000
26 S A -1.4241
27 N A -0.9502
28 S A -0.7503
29 A A -0.4609
30 F A 0.0000
31 Q A -0.4795
32 Y A 0.2052
33 F A 0.0000
34 M A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 R A -0.9279
38 Q A 0.0000
39 Y A -1.1991
40 S A -1.3839
41 R A -2.7149
42 K A -2.5132
43 G A -1.2948
44 P A 0.0000
45 E A -1.3365
46 L A -0.1362
47 L A -0.2724
48 M A 0.0000
49 Y A 0.0000
50 T A 0.1276
51 Y A 0.8694
52 S A -0.3223
53 S A -1.0125
54 G A -1.4514
55 N A -2.6476
56 K A -2.8615
57 E A -3.6620
58 D A -3.2051
59 G A -2.2548
60 R A -2.2103
61 F A 0.0000
62 T A -2.2306
63 A A 0.0000
64 Q A -1.8037
65 V A 0.0000
66 D A -1.4489
67 K A -1.1964
68 S A -0.8772
69 S A -0.7729
70 K A -0.9574
71 Y A -0.5633
72 I A 0.0000
73 S A 0.0000
74 L A 0.0000
75 F A -0.1547
76 I A 0.0000
77 R A -1.9685
78 D A -2.5344
79 S A 0.0000
80 Q A -1.5368
81 P A -0.4771
82 S A -0.3820
83 D A 0.0000
84 S A -0.4007
85 A A 0.0000
86 T A 0.0000
87 Y A 0.0000
88 L A 0.0000
89 C A 0.0000
90 A A 0.0000
91 M A 0.0000
92 S A 0.0000
93 A A -0.5811
94 D A -0.6251
95 N A 0.2045
96 Y A 0.8069
97 G A 0.0000
98 Q A -0.5092
99 N A -1.7110
100 F A 0.0000
101 V A -0.5448
102 F A 0.0000
103 G A 0.0000
104 P A -1.0819
105 G A -1.1360
106 T A 0.0000
107 R A -2.0862
108 L A 0.0000
109 S A -0.4556
110 V A 0.0000
111 L A 0.5357
112 P A -0.4920
113 G A -1.0523
114 G A -1.2210
115 G A -1.4883
116 S A -1.6729
117 E A -2.5162
118 G A -1.8110
119 G A -1.6757
120 G A -1.5309
121 S A -1.5998
122 E A -2.4564
123 G A -1.7911
124 G A -1.6311
125 G A -1.5436
126 S A -1.6158
127 E A -2.4702
128 G A -1.8325
129 G A -1.6721
130 G A -1.6765
131 S A -1.6586
132 E A -2.4484
133 G A -1.7656
134 G A -1.4603
135 T A -1.1532
136 G A -1.4907
137 N A -1.7964
138 A A -1.2001
139 G A -0.8234
140 V A -0.3980
141 T A -0.7328
142 Q A 0.0000
143 T A -0.7680
144 P A -0.7833
145 K A -1.3528
146 F A 0.5634
147 Q A 0.4820
148 V A 1.4476
149 L A 0.0000
150 K A -1.2807
151 T A -0.9345
152 G A -1.2530
153 Q A -1.6364
154 S A -0.9566
155 M A -0.5015
156 T A -0.6930
157 L A 0.0000
158 Q A -0.7231
159 C A 0.0000
160 A A -1.0100
161 Q A 0.0000
162 D A -2.6365
163 M A -1.4408
164 N A -2.1186
165 H A 0.0000
166 E A -0.7629
167 Y A 0.1114
168 M A 0.0000
169 S A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A 0.0000
173 Q A -0.4657
174 D A -0.3564
175 P A -0.3497
176 G A -0.6865
177 M A 0.0194
178 G A 0.0000
179 L A 0.0000
180 R A -1.3174
181 L A 0.0000
182 I A 0.0000
183 H A -1.7717
184 Y A -0.4935
185 S A 0.0000
186 V A 0.7379
187 G A 0.3072
188 A A 0.0148
189 G A 0.4198
190 I A 1.5430
191 T A -0.1257
192 D A -1.5388
193 Q A -2.7147
194 G A -2.3433
195 E A -2.5027
196 V A -1.4390
197 P A -1.9003
198 N A -1.8266
199 G A -1.0845
200 Y A 0.0000
201 N A -1.8727
202 V A -0.9466
203 S A -0.5791
204 R A 0.0000
205 S A -0.3867
206 T A -0.8239
207 T A -1.4304
208 E A -2.1425
209 D A -1.3816
210 F A 0.0000
211 P A -0.8243
212 L A 0.0000
213 R A -1.4789
214 L A 0.0000
215 L A -0.6277
216 S A -0.8827
217 A A 0.0000
218 A A -0.5350
219 P A -0.2979
220 S A -0.2727
221 Q A -0.3419
222 T A -0.1447
223 S A 0.0000
224 V A -0.5290
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 Y A 0.5232
232 S A 0.2935
233 V A 0.5454
234 G A -0.8807
235 E A -2.1829
236 G A -1.5833
237 N A -1.1213
238 L A 0.3092
239 G A 0.0000
240 D A 0.0000
241 T A 0.3763
242 Q A 0.0000
243 Y A 0.6186
244 F A 0.0585
245 G A 0.0000
246 P A -1.3658
247 G A 0.0000
248 T A 0.0000
249 R A -1.4232
250 L A 0.0000
251 T A 0.4654
252 V A 0.0000
253 L A 1.0602
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3572 2.8727 View CSV PDB
4.5 -0.4081 2.8177 View CSV PDB
5.0 -0.4735 2.7618 View CSV PDB
5.5 -0.5439 2.7013 View CSV PDB
6.0 -0.6085 2.6455 View CSV PDB
6.5 -0.6571 2.6039 View CSV PDB
7.0 -0.6851 2.5807 View CSV PDB
7.5 -0.6967 2.571 View CSV PDB
8.0 -0.6988 2.5676 View CSV PDB
8.5 -0.6943 2.5664 View CSV PDB
9.0 -0.683 2.5713 View CSV PDB