Project name: ea0a3d209b59e20

Status: done

Started: 2026-06-25 14:42:17
Chain sequence(s) A: MGFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDGGGGSCYRCSDCPNPFDKTQITELGNCNFCRTVYTYRDEDNYRIAKDCVASCVPQDRRGGKAGLVTECCDEDYCNASPKHLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:12)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:12)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:12)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:12)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ea0a3d209b59e20/tmp/folded.pdb                (00:01:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:43)
Show buried residues

Minimal score value
-4.2795
Maximal score value
1.113
Average score
-1.1366
Total score value
-255.739

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6801
2 G A -0.5686
3 F A -0.9434
4 D A -2.2804
5 A A -1.8930
6 S A -2.1570
7 N A -2.4106
8 F A 0.0000
9 K A -2.4226
10 D A -1.2970
11 F A 0.0000
12 S A -0.7992
13 S A -1.0248
14 I A 0.0000
15 A A -0.5450
16 S A -0.8481
17 A A -0.5324
18 S A -0.6437
19 S A 0.0000
20 S A -0.0572
21 W A 0.0000
22 Q A -0.7730
23 N A 0.0000
24 Q A -1.7488
25 S A -1.3520
26 G A -1.1429
27 S A 0.0000
28 T A -0.6395
29 M A 0.0000
30 I A -0.0588
31 I A 0.0000
32 Q A -1.5541
33 V A 0.0000
34 D A -0.8524
35 S A 0.2466
36 F A 1.1130
37 G A -0.5723
38 N A -1.0913
39 V A 0.0000
40 S A -1.1751
41 G A -0.7868
42 Q A -0.8237
43 Y A 0.0000
44 V A 0.0000
45 N A 0.0000
46 R A -2.2419
47 A A -1.7772
48 Q A -1.9134
49 G A -1.3608
50 T A -1.0748
51 G A -1.3315
52 C A 0.0000
53 Q A -2.4716
54 N A -2.1463
55 S A 0.0000
56 P A -1.1136
57 Y A 0.0000
58 P A -0.8450
59 L A 0.0000
60 T A -0.9479
61 G A -1.1580
62 R A -1.8283
63 V A -0.8213
64 N A -1.0115
65 G A -0.6796
66 T A -0.0165
67 F A 1.1027
68 I A 0.0000
69 A A -0.3857
70 F A 0.0000
71 S A -0.6145
72 V A 0.0000
73 G A -1.1055
74 W A 0.0000
75 N A -2.5586
76 N A -1.8414
77 S A -1.1339
78 T A -1.3883
79 E A -2.1438
80 N A -2.5036
81 C A -1.6388
82 N A -2.2308
83 S A -1.2502
84 A A -0.5554
85 T A 0.0000
86 G A -0.5204
87 W A 0.0000
88 T A -0.0966
89 G A 0.0000
90 Y A 1.1085
91 A A 0.0000
92 Q A -0.4496
93 V A -1.2123
94 N A -1.7470
95 G A -1.6759
96 N A -2.2205
97 N A -1.6493
98 T A 0.0000
99 E A 0.0000
100 I A 0.0000
101 V A 0.3091
102 T A 0.0000
103 S A -0.9793
104 W A -1.1490
105 N A -1.3349
106 L A 0.0000
107 A A -0.3119
108 Y A -0.7305
109 E A -1.9238
110 G A -1.0951
111 G A -1.0910
112 S A -0.9162
113 G A -1.0849
114 P A -0.7741
115 A A -0.0604
116 I A 0.7394
117 E A -0.9689
118 Q A -1.9160
119 G A -1.8224
120 Q A -1.8219
121 D A -1.1382
122 T A -0.6866
123 F A 0.0000
124 Q A -0.6089
125 Y A 0.0000
126 V A 0.4493
127 P A -0.3647
128 T A -0.5189
129 T A -1.1987
130 E A -2.6099
131 N A -1.8785
132 K A -2.2610
133 S A -1.4380
134 L A 0.1287
135 L A -1.4853
136 K A -2.2999
137 D A -2.6607
138 G A -2.2146
139 G A -1.9741
140 G A -2.5066
141 G A 0.0000
142 S A -1.9319
143 C A 0.0000
144 Y A 0.0000
145 R A -2.1987
146 C A -1.5739
147 S A -1.4945
148 D A -2.3652
149 C A -1.9043
150 P A -1.6508
151 N A -1.7755
152 P A -1.0326
153 F A -1.0131
154 D A -1.5885
155 K A -2.0293
156 T A -1.5041
157 Q A -1.8856
158 I A -1.6508
159 T A -1.6066
160 E A -2.2991
161 L A -1.2815
162 G A -1.6991
163 N A -1.8852
164 C A 0.0000
165 N A -2.0527
166 F A -1.1455
167 C A 0.0000
168 R A -0.6834
169 T A 0.0000
170 V A -0.5070
171 Y A 0.0000
172 T A -1.2690
173 Y A -2.8100
174 R A -3.5343
175 D A -3.8864
176 E A -4.2795
177 D A -3.7154
178 N A -3.3060
179 Y A -2.2296
180 R A -2.0813
181 I A 0.0000
182 A A -1.2799
183 K A 0.0000
184 D A -1.3710
185 C A -1.1217
186 V A -0.4251
187 A A -0.4987
188 S A -0.5249
189 C A 0.0000
190 V A -0.0004
191 P A -0.5501
192 Q A -1.6395
193 D A -3.2343
194 R A -3.6333
195 R A -4.1380
196 G A -2.6196
197 G A -2.5004
198 K A -3.9060
199 A A -3.1831
200 G A -2.7164
201 L A -1.4697
202 V A 0.0000
203 T A 0.0000
204 E A 0.0000
205 C A -0.3376
206 C A -0.8358
207 D A -1.4476
208 E A -2.2817
209 D A -2.4308
210 Y A -1.0365
211 C A -0.8291
212 N A 0.0000
213 A A -0.6084
214 S A -0.5519
215 P A -1.0746
216 K A -2.2726
217 H A -1.8431
218 L A -0.9449
219 E A -2.7195
220 H A -2.7320
221 H A -2.6949
222 H A -2.9039
223 H A -2.6620
224 H A -2.3644
225 H A -1.8827
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.861 3.0567 View CSV PDB
4.5 -0.931 3.0464 View CSV PDB
5.0 -1.0136 3.0356 View CSV PDB
5.5 -1.094 3.0247 View CSV PDB
6.0 -1.1574 3.0138 View CSV PDB
6.5 -1.1964 3.003 View CSV PDB
7.0 -1.2159 2.9923 View CSV PDB
7.5 -1.2251 2.9823 View CSV PDB
8.0 -1.2279 2.9736 View CSV PDB
8.5 -1.2229 2.9675 View CSV PDB
9.0 -1.2081 2.964 View CSV PDB